close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build b6ac112)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Charm + Sentinel : 1368585 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1368585.2 1368585.2 919.5 / 0.067% 289401.1 / 21.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Sentinel 1368585
Earth Shock 282123 20.6% 50.0 5.85sec 1694263 1624558 Direct 50.0 1230913 3536249 1694261 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.95 49.95 0.00 0.00 1.0429 0.0000 84636240.27 84636240.27 0.00 1624558.34 1624558.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.91 79.90% 1230912.70 719668 1572315 1230841.39 1018900 1436907 49130479 49130479 0.00
crit 10.04 20.10% 3536248.71 2066886 4515690 3537146.82 0 4377030 35505761 35505761 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 127136 9.3% 11.3 27.12sec 3369563 3260524 Direct 11.3 87671 254667 219572 79.0%  
Periodic 217.7 48201 193832 163787 79.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 217.70 217.70 1.0335 1.3697 38141613.73 38141613.73 0.00 123081.53 3260524.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.38 21.02% 87671.17 78256 95744 85700.28 0 95744 208589 208589 0.00
crit 8.94 78.98% 254667.18 224751 274977 254696.39 242417 266139 2276770 2276770 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.9 20.63% 48201.35 160 52660 48202.20 44407 50217 2164918 2164918 0.00
crit 172.8 79.37% 193831.56 132 211736 193841.00 185987 200593 33491337 33491337 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 375444 (570983) 27.4% (41.7%) 119.0 2.50sec 1440018 1110132 Direct 118.7 0 949211 949211 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.95 118.66 0.00 0.00 1.2972 0.0000 112632170.64 112632170.64 0.00 1110132.22 1110132.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 118.66 100.00% 949211.30 740969 1104142 947949.54 877771 1007841 112632171 112632171 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 179046 13.1% 71.2 4.15sec 754164 0 Direct 71.0 0 756508 756508 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.22 71.00 0.00 0.00 0.0000 0.0000 53713381.54 53713381.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 71.00 100.00% 756508.33 590511 879940 755488.79 689952 804884 53713382 53713382 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16493 1.2% 88.5 3.19sec 55925 0 Direct 88.5 46290 94446 55925 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.47 88.47 0.00 0.00 0.0000 0.0000 4947849.24 4947849.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.77 79.99% 46289.69 44469 49460 46290.24 44933 48075 3275900 3275900 0.00
crit 17.70 20.01% 94445.90 90716 100898 94444.27 90716 99430 1671949 1671949 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 65484 (130182) 4.8% (9.5%) 54.0 5.38sec 723317 548621 Direct 54.0 263965 759616 363841 20.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.99 53.99 0.00 0.00 1.3184 0.0000 19644752.04 19644752.04 0.00 548620.56 548620.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.11 79.85% 263964.71 155102 569291 267978.76 197577 526452 11380088 11380088 0.00
crit 10.88 20.15% 759616.32 445454 1635005 770656.02 0 1592585 8264664 8264664 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 64698 4.7% 60.5 6.52sec 320638 0 Direct 60.5 233106 669714 320643 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.53 60.53 0.00 0.00 0.0000 0.0000 19408802.43 19408802.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.40 79.95% 233105.84 130286 478205 235734.28 156086 447582 11281413 11281413 0.00
crit 12.14 20.05% 669713.63 374181 1373404 677249.42 374181 1327202 8127390 8127390 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 42971 (62663) 3.1% (4.6%) 3.0 120.47sec 6265822 0 Direct 91.9 116064 236771 140229 20.0%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 91.92 91.92 0.00 0.0000 0.6527 12890368.57 12890368.57 0.00 313291.10 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.52 79.98% 116064.33 116064 116064 116064.33 116064 116064 8533159 8533159 0.00
crit 18.40 20.02% 236771.23 236771 236771 236771.23 236771 236771 4357210 4357210 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19692 1.4% 36.1 7.38sec 163656 0 Direct 36.1 135409 276235 163652 20.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.09 36.09 0.00 0.00 0.0000 0.0000 5907097.55 5907097.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.85 79.94% 135409.19 135409 135409 135409.19 135409 135409 3907177 3907177 0.00
crit 7.24 20.06% 276234.76 276235 276235 276057.96 0 276235 1999920 1999920 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 237588 / 172507
Fire Blast 205587 10.9% 99.0 3.02sec 452406 225350 Direct 99.0 376997 754055 452403 20.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.99 98.99 0.00 0.00 2.0076 0.0000 44784663.89 44784663.89 0.00 225349.78 225349.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.19 80.00% 376996.96 360148 400575 377019.58 369084 388702 29855793 29855793 0.00
crit 19.80 20.00% 754055.26 720296 801150 754080.01 728071 786450 14928871 14928871 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32001 1.7% 11.0 28.51sec 630662 446975 Direct 11.0 111560 223151 134003 20.1%  
Periodic 114.0 40107 80229 48151 20.0% 74.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 11.05 113.97 113.97 1.4110 1.9486 6968787.41 6968787.41 0.00 29320.29 446975.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.83 79.88% 111560.17 106711 118689 111564.40 106711 116693 984755 984755 0.00
crit 2.22 20.12% 223151.28 213421 237378 203861.48 0 237378 496021 496021 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.1 79.95% 40107.36 20 44508 40110.19 38672 42017 3654644 3654644 0.00
crit 22.9 20.05% 80228.76 41 89017 80234.18 65744 87505 1833367 1833367 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 172425 / 22992
Lightning Blast 172425 1.7% 37.2 7.00sec 185382 181509 Direct 37.2 154329 308714 185378 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.20 37.20 0.00 0.00 1.0214 0.0000 6896990.55 6896990.55 0.00 181509.30 181509.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.72 79.89% 154328.99 148209 164846 154329.32 149702 161130 4586745 4586745 0.00
crit 7.48 20.11% 308713.94 296418 329692 308523.41 0 329692 2310246 2310246 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Sentinel
Ascendance 2.0 188.65sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 93.54sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1033 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.70sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8768 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.52sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.2 0.0 36.7sec 36.7sec 46.08% 62.79% 0.0(0.0) 7.8

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:46.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.21% 32.21% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.5 66.9 4.5sec 2.2sec 71.57% 77.97% 66.9(75.3) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.91%
  • elemental_focus_2:40.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.0 0.8 13.7sec 13.3sec 8.09% 18.99% 0.8(0.8) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.09%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 76.4sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 9.3 35.0sec 16.0sec 48.58% 43.68% 9.3(26.5) 1.2

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.69%
  • power_of_the_maelstrom_2:5.97%
  • power_of_the_maelstrom_3:36.92%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 94.0sec 94.0sec 25.54% 25.54% 40.2(40.2) 3.1

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.30% 16.16% 0.0(0.0) 0.4

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.00%
  • stormkeeper_2:3.00%
  • stormkeeper_3:4.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.6sec 100.00% 99.05% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.8 13.3sec
Lava Surge: Wasted 0.8 81.1sec
Lava Surge: During Lava Burst 9.8 28.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7220.0007.4962.4650.00011.396
Fire Elemental0.3800.0012.1320.5830.0003.830
Ascendance8.9160.001109.5698.8030.000109.569
Lava Burst0.8570.00011.8535.3630.00023.463

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Sentinel
earth_shock Maelstrom 50.0 5321.5 106.5 106.5 15904.7
flame_shock Maelstrom 11.3 207.4 18.3 18.3 183911.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 118.95 1385.17 (24.78%) 11.64 42.27 2.96%
Lava Burst Overload Maelstrom 71.22 606.60 (10.85%) 8.52 34.40 5.37%
Lightning Bolt Maelstrom 53.99 431.93 (7.73%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 60.53 358.80 (6.42%) 5.93 4.40 1.21%
Aftershock Maelstrom 61.27 1658.65 (29.67%) 27.07 0.00 0.00%
Resonance Totem Maelstrom 298.59 288.97 (5.17%) 0.97 9.62 3.22%
The Deceiver's Blood Pact Maelstrom 10.00 859.31 (15.37%) 85.90 206.24 19.36%
Resource RPS-Gain RPS-Loss
Maelstrom 18.63 18.43
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.95 12.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Charm + Sentinel Damage Per Second
Count 24999
Mean 1368585.18
Minimum 1062483.89
Maximum 1638438.34
Spread ( max - min ) 575954.46
Range [ ( max - min ) / 2 * 100% ] 21.04%
Standard Deviation 74174.9589
5th Percentile 1245634.91
95th Percentile 1490065.88
( 95th Percentile - 5th Percentile ) 244430.97
Mean Distribution
Standard Deviation 469.1330
95.00% Confidence Intervall ( 1367665.69 - 1369504.66 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11285
0.1 Scale Factor Error with Delta=300 46967593
0.05 Scale Factor Error with Delta=300 187870370
0.01 Scale Factor Error with Delta=300 4696759228
Priority Target DPS
Sample Data Charm + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1368585.18
Minimum 1062483.89
Maximum 1638438.34
Spread ( max - min ) 575954.46
Range [ ( max - min ) / 2 * 100% ] 21.04%
Standard Deviation 74174.9589
5th Percentile 1245634.91
95th Percentile 1490065.88
( 95th Percentile - 5th Percentile ) 244430.97
Mean Distribution
Standard Deviation 469.1330
95.00% Confidence Intervall ( 1367665.69 - 1369504.66 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11285
0.1 Scale Factor Error with Delta=300 46967593
0.05 Scale Factor Error with Delta=300 187870370
0.01 Scale Factor Error with Delta=300 4696759228
DPS(e)
Sample Data Charm + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1368585.18
Minimum 1062483.89
Maximum 1638438.34
Spread ( max - min ) 575954.46
Range [ ( max - min ) / 2 * 100% ] 21.04%
Damage
Sample Data Charm + Sentinel Damage
Count 24999
Mean 351922275.99
Minimum 269300645.17
Maximum 434180858.09
Spread ( max - min ) 164880212.91
Range [ ( max - min ) / 2 * 100% ] 23.43%
DTPS
Sample Data Charm + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.89 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.80 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.22 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 27.29 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.38 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 119.36 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.30 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.66 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.11 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.78 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 31.11 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQLKFLLILLLLLILLLLILALLNIILLLLILLLLLILLLMLLILLLLLILLNPJKKNL97LKLMNLPPNLPLNPPQNLPAPNNMPLQQNQQLNQQOQNLLPNPPJLNMNILLLLLIKLLNAPPLNLLLLLILLMPNPPL9NQQQLLNQHQQALJNQQQFLLLILLLLLLILLLNLLLLLIIGLLLLLLIL8NPPPLLNLLLLIGJLLLNQQQQLN9IAQQLLMNNQQLNPPLNLAPQNQQLPNLLLLL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides
0:03.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:04.168 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:04.967 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.767 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.556 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.337 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:08.107 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:08.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:09.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
0:09.900 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
0:10.666 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.423 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:12.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:13.441 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:14.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.459 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:16.218 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:17.226 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:18.236 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:19.246 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:20.257 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:21.016 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:22.027 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.027 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.168 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.307 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.161 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.8/125: 96% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.016 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.873 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.012 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.153 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.293 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.148 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.004 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.143 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.282 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.420 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.559 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.6/125: 78% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.698 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.691 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.830 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.970 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.563 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.043 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.156 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.607 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.059 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.146 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.598 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.7/125: 86% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.049 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.7/125: 97% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.590 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.042 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.130 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.582 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.671 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.782 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.895 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.007 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.118 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.232 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.232 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:08.685 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:09.776 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.2/125: 75% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:10.865 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.2/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:11.955 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.2/125: 82% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:13.047 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:14.528 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:16.007 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:17.489 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:18.600 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.712 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.193 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:22.673 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:23.785 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:25.267 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:26.747 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:28.228 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.6/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.337 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.9/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:30.817 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.300 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.300 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides
1:33.761 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(2)
1:34.844 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(3)
1:35.913 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(4)
1:36.969 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
1:38.334 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
1:39.668 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
1:40.984 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
1:42.286 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:43.253 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:44.540 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:45.828 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:47.139 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:48.123 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:49.434 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:50.747 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:51.502 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:52.813 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.4/125: 59% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.925 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.3/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.036 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.515 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.968 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.058 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.509 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.962 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.051 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.531 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.2/125: 71% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.643 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.9/125: 94% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.756 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.9/125: 84% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.868 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.980 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.459 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:11.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:13.360 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:14.811 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:16.264 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:17.354 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.466 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.947 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.427 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.539 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.539 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.020 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.500 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.613 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.8/125: 72% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.726 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.178 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:30.631 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:32.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:33.171 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:34.260 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.350 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:36.802 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.283 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.396 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.878 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.991 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.473 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.954 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.432 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.544 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.4/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.657 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.137 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.619 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.100 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.211 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.692 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.782 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.234 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.324 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.777 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.228 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.228 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:03.690 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
3:04.773 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:05.842 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
3:06.880 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(5)
3:07.904 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:08.917 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
3:08.917 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
3:10.252 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
3:11.554 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.7/125: 80% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:12.537 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.7/125: 97% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:13.522 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.834 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:16.145 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:17.129 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:18.111 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:19.421 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:20.734 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:21.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.1/125: 36% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:23.029 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.509 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.987 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.1/125: 83% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.097 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.577 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.057 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.018 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.498 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.588 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:36.679 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:37.770 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:39.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:40.675 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.157 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.636 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.596 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.707 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.187 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.942 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.054 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.535 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.015 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.976 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.088 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.200 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.160 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.641 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.124 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.3/125: 94% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.215 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.305 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.485 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.935 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.025 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.115 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.204 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.294 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.383 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.863 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.345 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.457 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.570 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.682 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.682 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.163 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.644 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.757 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.238 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.350 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.461 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.574 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.055 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.536 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.018 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.128 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.610 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.091 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.203 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.9/125: 68% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.316 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.1/125: 22% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.797 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.797 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:45.258 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:46.701 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
4:47.770 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.3/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
4:49.178 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
4:50.527 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
4:51.861 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
4:53.164 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.3/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:54.131 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:55.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:56.708 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:58.019 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:59.330 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Terror : 1361411 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1361411.0 1361411.0 950.4 / 0.070% 300629.1 / 22.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Terror 1361411
Earth Shock 286673 21.1% 48.9 5.97sec 1760374 1689991 Direct 48.9 1224573 3520125 1760403 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.85 48.85 0.00 0.00 1.0417 0.0000 86001957.61 86001957.61 0.00 1689991.11 1689991.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.45 76.66% 1224572.92 719668 1572315 1224511.74 1007602 1428128 45860758 45860758 0.00
crit 11.40 23.34% 3520125.01 2066886 4515690 3520135.20 2511450 4353361 40141200 40141200 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128642 9.4% 11.3 27.16sec 3411744 3299382 Direct 11.3 87716 254665 222033 80.5%  
Periodic 218.0 48219 193405 165496 80.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 218.02 218.02 1.0341 1.3674 38592867.48 38592867.48 0.00 124571.08 3299381.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.21 19.54% 87715.53 78256 95744 84535.52 0 95744 193904 193904 0.00
crit 9.10 80.46% 254665.10 224751 274977 254690.99 242417 265909 2317769 2317769 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.9 19.22% 48218.96 513 52660 48219.19 43796 50239 2021008 2021008 0.00
crit 176.1 80.78% 193405.38 135 211736 193414.99 185816 199529 34060186 34060186 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 381985 (558512) 28.1% (41.0%) 118.7 2.52sec 1411004 1090324 Direct 118.5 0 967183 967183 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.75 118.48 0.00 0.00 1.2941 0.0000 114593736.42 114593736.42 0.00 1090324.09 1090324.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 118.48 100.00% 967182.66 740969 1134059 965724.65 871930 1030702 114593736 114593736 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 159589 11.7% 62.3 4.76sec 768702 0 Direct 62.1 0 770780 770780 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.28 62.11 0.00 0.00 0.0000 0.0000 47876168.05 47876168.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 62.11 100.00% 770780.43 590511 903782 769612.58 684261 827296 47876168 47876168 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16938 1.2% 88.3 3.24sec 57552 0 Direct 88.3 46300 94448 57551 23.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.29 88.29 0.00 0.00 0.0000 0.0000 5081288.16 5081288.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.66 76.63% 46299.57 44469 49460 46299.63 44945 48083 3132495 3132495 0.00
crit 20.63 23.37% 94447.69 90716 100898 94446.96 90716 99444 1948793 1948793 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 69667 (133645) 5.1% (9.8%) 55.4 5.17sec 723713 549284 Direct 55.4 262218 754586 377256 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.40 55.40 0.00 0.00 1.3176 0.0000 20899369.61 20899369.61 0.00 549284.17 549284.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.45 76.64% 262218.14 155102 569291 266045.35 192976 496667 11132164 11132164 0.00
crit 12.94 23.36% 754585.76 445454 1635005 765263.07 0 1571540 9767206 9767206 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 63978 4.7% 57.5 6.62sec 333726 0 Direct 57.5 232119 667490 333727 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.51 57.51 0.00 0.00 0.0000 0.0000 19192882.03 19192882.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.09 76.66% 232118.92 130286 478205 234586.89 153418 412189 10233647 10233647 0.00
crit 13.42 23.34% 667490.33 374181 1373404 674359.44 376489 1304101 8959235 8959235 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 50886 3.7% 10.0 29.63sec 1532823 0 Direct 10.0 1233906 2517168 1532922 23.3%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.96 9.96 0.00 0.00 0.0000 0.0000 15265690.63 15265690.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.64 76.71% 1233905.72 1233906 1233906 1233905.72 1233906 1233906 9426232 9426232 0.00
crit 2.32 23.29% 2517167.67 2517168 2517168 2298165.32 0 2517168 5839458 5839458 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 244641 / 179425
Fire Blast 211784 11.4% 100.2 2.98sec 465104 232114 Direct 100.2 376912 753826 465102 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.19 100.19 0.00 0.00 2.0038 0.0000 46600557.98 46600557.98 0.00 232113.79 232113.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.75 76.60% 376912.40 360148 400575 376934.89 369342 389078 28928316 28928316 0.00
crit 23.44 23.40% 753826.20 720296 801150 753855.90 729181 782103 17672242 17672242 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32857 1.8% 11.1 28.29sec 649211 460942 Direct 11.1 111544 223176 137701 23.4%  
Periodic 115.2 40073 80145 49438 23.4% 74.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.13 11.13 115.19 115.19 1.4085 1.9438 7227564.51 7227564.51 0.00 30167.65 460941.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.52 76.57% 111543.83 106711 118689 111547.64 107478 117537 950862 950862 0.00
crit 2.61 23.43% 223175.51 213421 237378 211342.40 0 237378 582114 582114 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.3 76.63% 40073.05 20 44508 40075.49 38503 41772 3537073 3537073 0.00
crit 26.9 23.37% 80144.91 41 89017 80149.11 68311 85923 2157516 2157516 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177195 / 23628
Lightning Blast 177195 1.7% 37.2 7.00sec 190543 186565 Direct 37.2 154311 308713 190547 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.20 37.20 0.00 0.00 1.0213 0.0000 7087788.63 7087788.63 0.00 186564.94 186564.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.47 76.53% 154311.15 148209 164846 154311.62 149932 161315 4393080 4393080 0.00
crit 8.73 23.47% 308713.11 296418 329692 308694.41 0 329692 2694708 2694708 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Terror
Ascendance 2.0 188.04sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 92.59sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1024 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.71sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8767 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.55sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.7sec 36.7sec 45.13% 62.27% 0.0(0.0) 7.8

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:45.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.26% 32.26% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.9 69.1 4.5sec 2.2sec 72.92% 78.85% 69.1(78.3) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:31.13%
  • elemental_focus_2:41.79%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.1 0.7 13.7sec 13.2sec 8.06% 19.12% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.06%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.96% 29.96% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 76.0sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 9.3 34.9sec 16.0sec 48.06% 42.80% 9.3(26.4) 1.2

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.67%
  • power_of_the_maelstrom_2:6.01%
  • power_of_the_maelstrom_3:36.38%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.4sec 90.4sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.25% 15.70% 0.0(0.0) 0.3

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:2.99%
  • stormkeeper_2:2.98%
  • stormkeeper_3:4.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 99.21% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 82.3sec
Lava Surge: During Lava Burst 9.8 27.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7150.0006.6352.4450.00011.186
Fire Elemental0.4000.0012.1630.6260.0004.040
Ascendance8.5590.003106.6928.4290.000106.692
Lava Burst0.8570.00012.0675.4120.00021.993

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Terror
earth_shock Maelstrom 48.9 5176.1 106.0 106.0 16615.1
flame_shock Maelstrom 11.3 207.2 18.3 18.3 186227.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 118.75 1385.49 (25.45%) 11.67 39.46 2.77%
Lava Burst Overload Maelstrom 62.28 531.26 (9.76%) 8.53 29.28 5.22%
Lightning Bolt Maelstrom 55.40 443.18 (8.14%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 57.51 341.11 (6.27%) 5.93 3.97 1.15%
Aftershock Maelstrom 60.17 1615.01 (29.67%) 26.84 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.54 (5.32%) 0.97 9.06 3.03%
The Deceiver's Blood Pact Maelstrom 9.77 837.99 (15.39%) 85.80 197.15 19.05%
Resource RPS-Gain RPS-Loss
Maelstrom 18.15 17.94
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.03 8.90 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Charm + Terror Damage Per Second
Count 24999
Mean 1361410.96
Minimum 1081530.49
Maximum 1659918.50
Spread ( max - min ) 578388.01
Range [ ( max - min ) / 2 * 100% ] 21.24%
Standard Deviation 76665.4461
5th Percentile 1234927.20
95th Percentile 1488029.21
( 95th Percentile - 5th Percentile ) 253102.01
Mean Distribution
Standard Deviation 484.8846
95.00% Confidence Intervall ( 1360460.61 - 1362361.32 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12182
0.1 Scale Factor Error with Delta=300 50174495
0.05 Scale Factor Error with Delta=300 200697977
0.01 Scale Factor Error with Delta=300 5017449411
Priority Target DPS
Sample Data Charm + Terror Priority Target Damage Per Second
Count 24999
Mean 1361410.96
Minimum 1081530.49
Maximum 1659918.50
Spread ( max - min ) 578388.01
Range [ ( max - min ) / 2 * 100% ] 21.24%
Standard Deviation 76665.4461
5th Percentile 1234927.20
95th Percentile 1488029.21
( 95th Percentile - 5th Percentile ) 253102.01
Mean Distribution
Standard Deviation 484.8846
95.00% Confidence Intervall ( 1360460.61 - 1362361.32 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12182
0.1 Scale Factor Error with Delta=300 50174495
0.05 Scale Factor Error with Delta=300 200697977
0.01 Scale Factor Error with Delta=300 5017449411
DPS(e)
Sample Data Charm + Terror Damage Per Second (Effective)
Count 24999
Mean 1361410.96
Minimum 1081530.49
Maximum 1659918.50
Spread ( max - min ) 578388.01
Range [ ( max - min ) / 2 * 100% ] 21.24%
Damage
Sample Data Charm + Terror Damage
Count 24999
Mean 347503959.99
Minimum 270804157.08
Maximum 429903662.81
Spread ( max - min ) 159099505.73
Range [ ( max - min ) / 2 * 100% ] 22.89%
DTPS
Sample Data Charm + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.86 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.69 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.20 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 26.05 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.26 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 119.16 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.42 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.81 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.14 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 15.01 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 32.39 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQFLLLIILLLLLLILLLLLILLLLLILLLLLIILLLGLLNPPQNLQQNQJLQMQNQQL97LNNPLLNLLLLLLIALLLLLILLLGNLPPPLNOQQQLLNIIJLKKKILLGLLLILLLLILLLLLILL9LLLGILLLLLLILLLHLALIJKKKLLFILLLLILLLLIILLLLLILLLGLNNLLLLLL8ILLNNL9LLLJKGKIKLLNQQQLNQQQQLMNAQQQLNQQLNQLQQNQQLQNQQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:03.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
0:04.190 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.006 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.820 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
0:06.624 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
0:07.419 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.204 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:08.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:09.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.261 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:11.270 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.029 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.788 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.797 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.818 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:16.827 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:17.837 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:18.846 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:19.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:20.613 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:21.624 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.763 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.881 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.000 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.839 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.676 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.1/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.051 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.189 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.1/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.045 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.185 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.325 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.464 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.743 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.4/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.597 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.454 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.571 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.410 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.862 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.952 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.404 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.856 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.968 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.449 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.930 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.411 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.522 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.003 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.482 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.960 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.071 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.553 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.665 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.145 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.256 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.367 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.479 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.591 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.6/125: 18% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.704 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.183 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.663 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.774 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.774 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:13.885 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:14.996 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.8/125: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:16.108 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:17.591 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.071 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:20.182 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.295 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.777 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.132 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.582 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.063 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.175 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.175 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.637 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
1:34.052 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
1:35.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
1:36.814 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
1:38.162 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
1:39.182 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
1:40.508 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:41.821 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:42.787 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:43.755 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:44.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:45.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:46.979 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:48.268 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:49.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:50.891 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.8/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:51.875 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.631 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.111 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.591 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.071 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.183 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.6/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.663 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.6/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.750 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.838 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.927 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.017 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.467 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.557 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.668 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.780 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.891 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.853 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:13.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:15.443 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.924 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.404 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.515 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.589 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.068 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.177 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.109 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.011 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.462 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.033 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.514 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.886 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.367 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.847 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.959 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.071 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.181 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.661 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.141 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.591 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.041 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.8/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.492 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.580 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.031 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.510 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.989 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.100 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.581 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.581 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:03.043 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
3:04.126 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:05.196 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
3:06.254 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
3:07.297 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
3:08.327 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:09.684 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
3:11.010 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:11.010 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:11.996 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:13.308 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.619 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:15.931 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.1/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:17.244 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:18.228 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:19.214 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:20.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:21.838 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:23.288 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.378 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.468 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.371 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.851 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.333 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.814 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.926 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.038 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.149 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.632 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.4/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.745 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.226 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.337 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.449 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.930 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:45.384 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.288 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.3/125: 83% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.192 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.948 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.061 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.022 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.132 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.7/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.243 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.722 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:00.810 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.261 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:03.713 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.164 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.303 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.415 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.527 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.640 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.752 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.863 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.453 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.563 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.9/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.043 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.524 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.004 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.485 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.9/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:22.597 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.076 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.556 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.036 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.489 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.942 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.7/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.031 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.119 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.119 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides
4:33.550 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
4:34.991 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
4:36.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(5)
4:37.808 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(6)
4:38.839 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
4:40.171 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
4:41.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:42.440 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:43.408 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:44.695 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:45.983 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:47.272 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:48.562 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:49.547 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:50.858 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:52.148 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.598 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.050 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.140 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.593 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.074 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Thurible : 1338082 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1338082.0 1338082.0 942.5 / 0.070% 298679.2 / 22.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Thurible 1338082
Earth Shock 281238 21.0% 48.9 5.98sec 1725710 1656613 Direct 48.9 1255987 3604221 1725743 20.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.89 48.89 0.00 0.00 1.0417 0.0000 84369631.68 84369631.68 0.00 1656612.77 1656612.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.11 80.00% 1255987.30 738620 1613722 1255962.86 997620 1462642 49122456 49122456 0.00
crit 9.78 20.00% 3604221.22 2121317 4634609 3603406.58 2227382 4486302 35247175 35247175 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 130573 9.8% 11.3 27.16sec 3463640 3350338 Direct 11.3 89967 261414 224995 78.8%  
Periodic 218.0 49469 198963 168006 79.3% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 218.01 218.01 1.0339 1.3674 39172152.26 39172152.26 0.00 126442.95 3350338.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.40 21.24% 89967.00 80317 98266 88039.80 0 98266 216116 216116 0.00
crit 8.91 78.76% 261414.28 230670 282219 261445.50 247556 273147 2328514 2328514 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.1 20.71% 49469.10 176 54047 49470.61 45617 51651 2233172 2233172 0.00
crit 172.9 79.29% 198962.85 135 217312 198972.34 190305 205710 34394350 34394350 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 384290 (561874) 28.7% (42.0%) 118.7 2.52sec 1419882 1097063 Direct 118.5 0 973263 973263 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.71 118.45 0.00 0.00 1.2943 0.0000 115283787.19 115283787.19 0.00 1097063.32 1097063.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 118.45 100.00% 973263.09 760482 1133219 971931.90 879882 1032466 115283787 115283787 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 160692 12.0% 62.3 4.76sec 773491 0 Direct 62.1 0 775647 775647 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.32 62.15 0.00 0.00 0.0000 0.0000 48205902.37 48205902.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 62.15 100.00% 775646.70 606062 903113 774566.81 687639 826677 48205902 48205902 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16892 1.3% 88.3 3.19sec 57405 0 Direct 88.3 47514 96927 57405 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.28 88.28 0.00 0.00 0.0000 0.0000 5067506.97 5067506.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.61 79.98% 47514.44 45640 50762 47514.07 46078 49303 3354758 3354758 0.00
crit 17.67 20.02% 96926.71 93105 103555 96924.73 93105 103555 1712749 1712749 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 68284 (131209) 5.1% (9.8%) 55.4 5.13sec 710493 539262 Direct 55.4 268605 772385 369739 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.40 55.40 0.00 0.00 1.3175 0.0000 20484705.77 20484705.77 0.00 539262.04 539262.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.28 79.92% 268605.44 159187 584284 272619.63 205238 541662 11893367 11893367 0.00
crit 11.12 20.08% 772384.94 457185 1678062 783243.10 461132 1678062 8591339 8591339 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 62925 4.7% 57.6 6.55sec 327724 0 Direct 57.6 237882 684440 327714 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.60 57.60 0.00 0.00 0.0000 0.0000 18877108.86 18877108.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.01 79.88% 237882.14 133717 490798 240534.19 161732 456499 10945842 10945842 0.00
crit 11.59 20.12% 684439.63 384035 1409572 691670.32 0 1382215 7931267 7931267 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32312 2.4% 16.6 17.95sec 583678 0 Direct 16.5 487076 993635 588834 20.1%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.61 16.46 0.00 0.00 0.0000 0.0000 9693502.83 9693502.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.16 79.91% 487076.02 487076 487076 487076.02 487076 487076 6407897 6407897 0.00
crit 3.31 20.09% 993635.07 993635 993635 963864.57 0 993635 3285606 3285606 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 244524 / 177269
Fire Blast 211636 11.5% 99.1 3.02sec 464549 232040 Direct 99.1 386942 773903 464546 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.09 99.09 0.00 0.00 2.0020 0.0000 46030095.09 46030095.09 0.00 232040.44 232040.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.21 79.94% 386942.41 369632 411124 386965.13 379538 397308 30650990 30650990 0.00
crit 19.87 20.06% 773902.57 739265 822248 773946.61 747244 806853 15379105 15379105 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32888 1.8% 11.0 28.65sec 648633 460781 Direct 11.0 114500 229034 137565 20.1%  
Periodic 114.1 41138 82267 49397 20.1% 73.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 114.06 114.06 1.4077 1.9426 7150865.62 7150865.62 0.00 30160.72 460781.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.80 79.86% 114499.58 109521 121815 114506.70 110309 121815 1008062 1008062 0.00
crit 2.22 20.14% 229033.62 219041 243629 209525.95 0 243629 508556 508556 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.2 79.92% 41137.66 21 45680 41140.16 39495 42921 3749909 3749909 0.00
crit 22.9 20.08% 82266.72 42 91361 82268.18 65130 88879 1884339 1884339 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177033 / 23606
Lightning Blast 177033 1.8% 37.2 7.00sec 190379 186390 Direct 37.2 158403 316873 190378 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.20 37.20 0.00 0.00 1.0214 0.0000 7081319.14 7081319.14 0.00 186389.74 186389.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.69 79.82% 158402.74 152112 169187 158401.57 153924 165654 4703070 4703070 0.00
crit 7.51 20.18% 316873.19 304224 338374 316834.55 0 338374 2378249 2378249 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Thurible
Ascendance 2.0 188.06sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 93.77sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1005 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.68sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8768 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.42sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.2 0.0 36.7sec 36.7sec 45.11% 62.24% 0.0(0.0) 7.8

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:45.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.23% 32.23% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.1 67.1 4.5sec 2.2sec 71.40% 77.60% 67.1(75.4) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.87%
  • elemental_focus_2:40.53%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.1 0.7 13.7sec 13.2sec 8.04% 19.11% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.04%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 76.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 9.3 35.0sec 16.0sec 48.08% 42.84% 9.3(26.4) 1.2

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.67%
  • power_of_the_maelstrom_2:5.99%
  • power_of_the_maelstrom_3:36.42%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Spear of Anguish 16.6 0.0 17.9sec 17.9sec 16.53% 16.53% 0.0(0.0) 16.5

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.26% 15.70% 0.0(0.0) 0.3

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:2.98%
  • stormkeeper_2:2.99%
  • stormkeeper_3:4.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 99.16% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 80.4sec
Lava Surge: During Lava Burst 9.8 28.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7120.0008.1582.4240.00011.866
Fire Elemental0.3820.0011.8690.5800.0003.859
Ascendance8.6610.002104.8118.5340.000104.811
Lava Burst0.8580.00010.0065.4230.00021.786

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Thurible
earth_shock Maelstrom 48.9 5178.8 105.9 105.9 16291.3
flame_shock Maelstrom 11.3 207.2 18.3 18.3 189066.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 118.71 1385.13 (25.43%) 11.67 39.39 2.76%
Lava Burst Overload Maelstrom 62.32 531.61 (9.76%) 8.53 29.28 5.22%
Lightning Bolt Maelstrom 55.40 443.22 (8.14%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 57.60 341.63 (6.27%) 5.93 3.98 1.15%
Aftershock Maelstrom 60.20 1615.80 (29.67%) 26.84 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.53 (5.32%) 0.97 9.07 3.04%
The Deceiver's Blood Pact Maelstrom 9.78 839.15 (15.41%) 85.78 197.27 19.03%
Resource RPS-Gain RPS-Loss
Maelstrom 18.15 17.95
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 63.65 11.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Thurible Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Charm + Thurible Damage Per Second
Count 24999
Mean 1338081.98
Minimum 1015301.47
Maximum 1621830.59
Spread ( max - min ) 606529.11
Range [ ( max - min ) / 2 * 100% ] 22.66%
Standard Deviation 76027.9120
5th Percentile 1211832.24
95th Percentile 1463264.62
( 95th Percentile - 5th Percentile ) 251432.38
Mean Distribution
Standard Deviation 480.8524
95.00% Confidence Intervall ( 1337139.53 - 1339024.43 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12402
0.1 Scale Factor Error with Delta=300 49343483
0.05 Scale Factor Error with Delta=300 197373930
0.01 Scale Factor Error with Delta=300 4934348230
Priority Target DPS
Sample Data Charm + Thurible Priority Target Damage Per Second
Count 24999
Mean 1338081.98
Minimum 1015301.47
Maximum 1621830.59
Spread ( max - min ) 606529.11
Range [ ( max - min ) / 2 * 100% ] 22.66%
Standard Deviation 76027.9120
5th Percentile 1211832.24
95th Percentile 1463264.62
( 95th Percentile - 5th Percentile ) 251432.38
Mean Distribution
Standard Deviation 480.8524
95.00% Confidence Intervall ( 1337139.53 - 1339024.43 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12402
0.1 Scale Factor Error with Delta=300 49343483
0.05 Scale Factor Error with Delta=300 197373930
0.01 Scale Factor Error with Delta=300 4934348230
DPS(e)
Sample Data Charm + Thurible Damage Per Second (Effective)
Count 24999
Mean 1338081.98
Minimum 1015301.47
Maximum 1621830.59
Spread ( max - min ) 606529.11
Range [ ( max - min ) / 2 * 100% ] 22.66%
Damage
Sample Data Charm + Thurible Damage
Count 24999
Mean 341154297.92
Minimum 255357007.26
Maximum 419401737.53
Spread ( max - min ) 164044730.26
Range [ ( max - min ) / 2 * 100% ] 24.04%
DTPS
Sample Data Charm + Thurible Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Thurible Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Thurible Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Thurible Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Thurible Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Thurible Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + ThuribleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Thurible Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.87 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.70 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.21 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 26.03 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.28 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 119.12 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.40 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.86 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.13 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 15.02 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 32.38 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLKHKKLLFLLILLLLLILLLLLIILLLLIILLLLILLMPNPLNPLLNQQLNLNPPPNJLQMQNQLQQLNILLQN97QQLQNQAQLLMNQQQLNQQQQLNLOPPNLPQNJQLKKLLMNPPPLNQQQLNPPPNLLMLLLLLILLLNPPPLNPHPPALJNL9LLLLILLNQLFLLLILLLLLILLGLLLLILLLNL8PPLLNIMPQQJLNQQQLLNLLLLLILL9LLLALILGLQLNLPLNNLLNNPPLLLIM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.955 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides
0:03.080 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(2)
0:03.916 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(3)
0:04.739 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.3/125: 17% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.552 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
0:06.355 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
0:07.150 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.3/125: 68% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.195 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:08.195 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:09.228 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.3/125: 89% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:09.994 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.760 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:11.770 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:12.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:13.790 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.2/125: 79% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.807 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.2/125: 97% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:16.565 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:17.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:18.586 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.330 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.322 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.161 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.999 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.235 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:26.354 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:27.472 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:28.311 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:29.149 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:30.266 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.500 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.618 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.475 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:36.446 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.284 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.402 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.241 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.359 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom bloodlust, lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.198 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.309 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.788 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:46.378 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:47.490 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:48.973 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:51.567 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:52.679 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:54.159 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.269 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.748 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:58.201 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
0:59.650 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.739 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.827 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.278 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:04.388 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:05.500 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.611 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.722 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.833 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.313 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.794 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.274 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.386 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.496 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.722 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.202 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.684 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.773 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 29.7/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.863 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.863 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.315 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.766 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.217 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.698 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.812 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.292 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.292 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.753 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
1:33.836 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.1/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(3)
1:35.260 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.1/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
1:36.317 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
1:37.348 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.1/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
1:38.705 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
1:40.045 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:41.371 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:42.682 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:43.667 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:44.979 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:46.290 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:47.600 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:48.911 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:50.223 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:51.208 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:52.194 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.948 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.400 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.851 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:58.394 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.874 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.356 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.468 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.581 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.8/125: 20% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.804 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.916 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.8/125: 54% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.027 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.139 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.8/125: 81% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.620 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.731 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.8/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.843 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.324 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.804 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.282 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.763 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.4/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:19.876 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.357 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.839 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.320 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.800 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.913 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.394 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.874 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.324 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.6/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:32.413 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:33.865 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.956 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.045 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.005 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.457 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.9/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.909 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.9/125: 91% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.362 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.903 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:47.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:48.496 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.607 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.088 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.569 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.052 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.533 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:56.645 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:58.126 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.239 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.721 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.203 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.203 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:03.666 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
3:04.749 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
3:05.818 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
3:07.224 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(6)
3:08.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(7)
3:09.573 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(8)
3:10.890 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(9)
3:12.192 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:13.481 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:14.465 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:15.776 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:17.088 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:18.073 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:19.057 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:20.043 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.8/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:20.043 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.8/125: 50% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:21.353 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:22.665 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.8/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.146 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.8/125: 97% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.257 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.737 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.218 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.699 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.8/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.660 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.8/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.253 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.733 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.846 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.325 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.776 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:43.681 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:44.770 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.332 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.813 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.925 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.9/125: 20% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.036 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.792 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.272 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:54.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:56.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.9/125: 83% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:57.628 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.9/125: 94% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:58.717 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:59.806 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.918 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.400 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.879 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:05.359 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:06.470 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.952 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.063 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.177 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.287 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.398 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.879 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.992 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.103 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.584 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.063 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:20.514 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:21.603 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:23.055 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.144 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.595 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:27.075 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:28.187 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:29.668 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.148 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.628 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.628 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:34.089 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:35.171 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(3)
4:36.596 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(4)
4:37.651 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:39.025 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:40.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
4:41.390 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:42.385 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:43.370 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:44.681 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:45.992 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:46.977 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.6/125: 92% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:47.961 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:48.945 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:50.257 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:51.240 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.1/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:52.224 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:53.535 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.014 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.606 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.719 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.832 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Thurible"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=spectral_thurible,id=147018,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Tome : 1356940 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1356939.7 1356939.7 955.8 / 0.070% 301982.7 / 22.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Tome 1356940
Earth Shock 292391 21.5% 48.6 6.01sec 1805331 1722383 Direct 48.6 1285435 3682153 1805440 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.59 48.59 0.00 0.00 1.0482 0.0000 87715823.33 87715823.33 0.00 1722383.48 1722383.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.05 78.31% 1285435.47 756882 1645414 1285310.19 1073426 1508086 48905441 48905441 0.00
crit 10.54 21.69% 3682152.91 2173764 4725629 3681121.01 2544450 4650019 38810383 38810383 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 133473 9.8% 11.3 27.13sec 3535317 3406987 Direct 11.3 92080 267269 231911 79.8%  
Periodic 216.8 50647 203166 172577 79.9% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 216.81 216.81 1.0377 1.3752 40042317.52 40042317.52 0.00 129209.61 3406986.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.29 20.18% 92080.12 82303 100195 89422.05 0 100195 210488 210488 0.00
crit 9.04 79.82% 267269.33 236373 287761 267296.22 255219 278756 2416242 2416242 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.5 20.06% 50646.54 36 55108 50649.18 46899 52965 2202273 2202273 0.00
crit 173.3 79.94% 203166.17 97 221580 203177.43 195089 209901 35213314 35213314 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13365 1.0% 5.0 63.16sec 801810 0 Periodic 47.0 70589 143971 85299 20.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4009051.97 4009051.97 0.00 66817.53 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.95% 70589.37 9957 76542 70589.77 66175 76542 2652656 2652656 0.00
crit 9.4 20.05% 143971.45 20312 156146 143903.17 0 156146 1356395 1356395 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 393548 (575278) 29.0% (42.4%) 118.0 2.52sec 1463071 1125348 Direct 117.7 0 1003175 1003175 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.96 117.69 0.00 0.00 1.3001 0.0000 118063050.02 118063050.02 0.00 1125348.32 1125348.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 117.69 100.00% 1003175.18 779284 1228596 1001668.06 919482 1066684 118063050 118063050 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 164322 12.1% 61.8 4.76sec 797249 0 Direct 61.7 0 799470 799470 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.83 61.66 0.00 0.00 0.0000 0.0000 49295672.85 49295672.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 61.66 100.00% 799469.87 621046 979123 798252.09 719205 855706 49295673 49295673 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 17408 1.3% 87.8 3.21sec 59508 0 Direct 87.8 48594 99137 59508 21.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.76 87.76 0.00 0.00 0.0000 0.0000 5222444.30 5222444.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.81 78.41% 48593.81 46768 51759 48594.05 47282 50463 3343685 3343685 0.00
crit 18.95 21.59% 99136.93 95407 105588 99138.19 95407 104022 1878759 1878759 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 70596 (135409) 5.2% (10.0%) 55.1 5.27sec 737643 554469 Direct 55.1 277131 774672 384589 21.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.07 55.07 0.00 0.00 1.3304 0.0000 21178321.66 21178321.66 0.00 554468.77 554468.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.18 78.40% 277131.08 163122 595758 281153.46 211046 560402 11965199 11965199 0.00
crit 11.89 21.60% 774672.33 468488 1711017 785229.75 490166 1679285 9213123 9213123 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 64812 4.8% 57.3 6.69sec 339097 0 Direct 57.3 245190 683196 339108 21.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.34 57.34 0.00 0.00 0.0000 0.0000 19443169.28 19443169.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.04 78.56% 245190.24 137023 500437 247740.87 167174 470940 11044271 11044271 0.00
crit 12.29 21.44% 683195.76 393530 1437255 690460.08 0 1394606 8398898 8398898 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 251081 / 183020
Fire Blast 217261 11.7% 98.8 3.02sec 480785 238209 Direct 98.8 395636 791314 480783 21.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.82 98.82 0.00 0.00 2.0183 0.0000 47513122.89 47513122.89 0.00 238208.78 238208.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.56 78.48% 395635.89 378771 419198 395660.71 387727 405738 30684496 30684496 0.00
crit 21.27 21.52% 791313.74 757542 838397 791333.64 766024 822299 16828627 16828627 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33819 1.8% 11.1 28.40sec 666299 470147 Direct 11.1 117082 234147 142134 21.4%  
Periodic 113.7 42101 84212 51160 21.5% 74.2%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 11.10 113.70 113.70 1.4173 1.9583 7394000.76 7394000.76 0.00 31018.10 470146.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.72 78.60% 117082.29 112229 124207 117089.42 113150 122978 1021183 1021183 0.00
crit 2.38 21.40% 234147.31 224457 248414 218301.61 0 248414 556147 556147 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.2 78.49% 42100.77 21 46578 42102.51 40596 44023 3756939 3756939 0.00
crit 24.5 21.51% 84211.69 43 93155 84208.66 72803 90247 2059731 2059731 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 180017 / 24004
Lightning Blast 180017 1.8% 37.0 7.03sec 194613 187792 Direct 37.0 162012 324102 194612 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0363 0.0000 7200678.90 7200678.90 0.00 187791.54 187791.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.56 79.89% 162012.41 155873 172510 162011.36 157596 169083 4788767 4788767 0.00
crit 7.44 20.11% 324102.17 311746 345019 324062.58 0 345019 2411912 2411912 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Tome
Ascendance 2.0 189.18sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 92.79sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1061 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8651 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.73sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.8sec 36.8sec 44.78% 62.00% 0.0(0.0) 7.8

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:44.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.22% 32.22% 3.0(3.0) 8.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.2 67.6 4.5sec 2.2sec 72.15% 78.26% 67.6(76.4) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.90%
  • elemental_focus_2:41.25%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 63.2sec 63.2sec 19.84% 19.84% 0.0(0.0) 4.7

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.9 0.7 13.8sec 13.3sec 8.05% 19.08% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.05%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 76.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 9.3 35.0sec 16.0sec 47.93% 42.99% 9.3(26.2) 1.2

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.70%
  • power_of_the_maelstrom_2:6.04%
  • power_of_the_maelstrom_3:36.19%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 97.9sec 97.9sec 21.69% 21.69% 33.0(33.0) 3.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.32%
  • rising_tides_2:1.29%
  • rising_tides_3:1.26%
  • rising_tides_4:1.22%
  • rising_tides_5:1.19%
  • rising_tides_6:1.15%
  • rising_tides_7:1.11%
  • rising_tides_8:1.08%
  • rising_tides_9:1.04%
  • rising_tides_10:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.34% 15.76% 0.0(0.0) 0.4

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.03%
  • stormkeeper_2:2.99%
  • stormkeeper_3:4.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.6sec 100.00% 98.90% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.7 13.3sec
Lava Surge: Wasted 0.8 82.2sec
Lava Surge: During Lava Burst 9.8 28.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7100.0016.9372.3580.00013.101
Fire Elemental0.3940.0012.0690.6030.0003.925
Ascendance9.0700.001107.0228.9640.000107.022
Lava Burst0.8620.00010.4925.5050.00020.614

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Tome
earth_shock Maelstrom 48.6 5145.5 105.9 105.9 17047.0
flame_shock Maelstrom 11.3 207.5 18.3 18.3 192947.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 117.96 1376.53 (25.43%) 11.67 39.03 2.76%
Lava Burst Overload Maelstrom 61.84 527.59 (9.75%) 8.53 28.93 5.20%
Lightning Bolt Maelstrom 55.06 440.51 (8.14%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 57.33 340.17 (6.28%) 5.93 3.84 1.12%
Aftershock Maelstrom 59.91 1605.92 (29.67%) 26.80 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.54 (5.35%) 0.97 9.06 3.03%
The Deceiver's Blood Pact Maelstrom 9.71 832.72 (15.38%) 85.77 195.25 18.99%
Resource RPS-Gain RPS-Loss
Maelstrom 18.04 17.84
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.32 9.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Charm + Tome Damage Per Second
Count 24999
Mean 1356939.70
Minimum 1045505.47
Maximum 1644981.60
Spread ( max - min ) 599476.13
Range [ ( max - min ) / 2 * 100% ] 22.09%
Standard Deviation 77106.3642
5th Percentile 1229282.08
95th Percentile 1483240.20
( 95th Percentile - 5th Percentile ) 253958.12
Mean Distribution
Standard Deviation 487.6732
95.00% Confidence Intervall ( 1355983.88 - 1357895.53 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12404
0.1 Scale Factor Error with Delta=300 50753281
0.05 Scale Factor Error with Delta=300 203013123
0.01 Scale Factor Error with Delta=300 5075328054
Priority Target DPS
Sample Data Charm + Tome Priority Target Damage Per Second
Count 24999
Mean 1356939.70
Minimum 1045505.47
Maximum 1644981.60
Spread ( max - min ) 599476.13
Range [ ( max - min ) / 2 * 100% ] 22.09%
Standard Deviation 77106.3642
5th Percentile 1229282.08
95th Percentile 1483240.20
( 95th Percentile - 5th Percentile ) 253958.12
Mean Distribution
Standard Deviation 487.6732
95.00% Confidence Intervall ( 1355983.88 - 1357895.53 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 125
0.1% Error 12404
0.1 Scale Factor Error with Delta=300 50753281
0.05 Scale Factor Error with Delta=300 203013123
0.01 Scale Factor Error with Delta=300 5075328054
DPS(e)
Sample Data Charm + Tome Damage Per Second (Effective)
Count 24999
Mean 1356939.70
Minimum 1045505.47
Maximum 1644981.60
Spread ( max - min ) 599476.13
Range [ ( max - min ) / 2 * 100% ] 22.09%
Damage
Sample Data Charm + Tome Damage
Count 24999
Mean 344969850.92
Minimum 258354378.19
Maximum 427902165.74
Spread ( max - min ) 169547787.55
Range [ ( max - min ) / 2 * 100% ] 24.57%
DTPS
Sample Data Charm + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.85 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.69 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.20 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 25.84 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.23 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 118.37 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.43 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.75 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.15 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 15.04 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 32.08 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLLILLLLLIILLLALLNPPNLLLLLILLLLILPMPPNLQLNLLLLLIJKKKLLIIMQQQ97LLNLALLLLLILLNMPLPNLAPQNQQLNOQQQQLNLLJLLKIKKLLGLILLLLALLILLLLLILLLLILML9LLLLIPPPNLHQQJNLLQNNIALLLLLLILLHFLLLLILALLLILLLLNOPPQLLNQMQQLNQQQJLNQQQQLNL9LLLLLILMPPANPLLNLLLLLLILLLNAIPPPL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides
0:03.059 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:04.149 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:04.949 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.748 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.538 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.318 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
0:07.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
0:08.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(8)
0:09.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
0:10.163 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.173 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.180 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.939 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.697 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.706 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.716 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:16.726 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:17.735 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.489 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.243 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.998 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.991 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.982 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.982 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.102 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.219 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.058 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.176 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.295 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.253 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom bloodlust, ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.370 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.486 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.3/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.744 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.599 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.856 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.972 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.809 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.648 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.767 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.883 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.996 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.477 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.959 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:47.068 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.548 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.999 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.089 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.7/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.4/125: 25% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.587 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.037 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.4/125: 83% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.488 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.576 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.665 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.755 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.866 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.979 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.458 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.937 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.047 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.158 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.268 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.749 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.228 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.708 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.799 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.799 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:17.890 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:19.342 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:20.433 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.885 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.885 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.335 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.787 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.6/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.239 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.6/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.689 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.6/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.171 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:30.282 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.761 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.240 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.350 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:35.462 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.7/125: 16% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.945 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:38.035 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:39.488 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.578 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:42.032 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:42.032 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides
1:43.464 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
1:44.880 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
1:45.930 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
1:47.313 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
1:48.663 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
1:50.021 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
1:51.029 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:51.783 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:53.072 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:54.359 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:55.649 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:56.937 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:58.226 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:59.194 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
2:00.484 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
2:01.772 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
2:02.741 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.192 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:05.643 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.733 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.844 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.956 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.068 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.549 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.028 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.118 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.208 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.297 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.749 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:19.199 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:20.651 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.104 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:23.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.4/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:25.008 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.097 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:27.548 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.027 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.8/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.101 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.215 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:35.327 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.808 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.289 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.770 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.881 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:41.993 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.587 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.9/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:47.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.290 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.9/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.770 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.9/125: 88% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.251 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.363 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.844 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.296 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.748 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.839 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.291 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.381 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.833 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.313 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.425 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.647 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.128 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.238 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.350 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.8/125: 88% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.463 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.575 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:14.037 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
3:15.480 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:16.903 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
3:18.295 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:19.307 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
3:20.640 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
3:21.618 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:22.908 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:24.197 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:25.180 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:25.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:26.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:27.802 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:29.113 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:30.424 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:31.407 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:32.721 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.721 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.833 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.314 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.425 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.988 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.077 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.528 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.980 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.8/125: 79% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.092 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.846 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.326 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:47.807 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:49.287 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:50.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:51.877 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.2/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:52.987 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:54.469 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:55.578 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:57.029 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.482 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.932 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.024 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.476 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.956 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.435 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.547 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.026 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.7/125: 70% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.137 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.248 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.360 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.472 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.436 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.548 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.029 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.141 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.622 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.2/125: 50% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.103 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.214 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.695 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.2/125: 89% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.176 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.288 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:28.768 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.858 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.310 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.761 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.761 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.852 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.303 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.415 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.896 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.8/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.007 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.488 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.598 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.078 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.528 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.980 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:47.430 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:48.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:49.998 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:51.477 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:52.587 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:53.697 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:53.697 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, rising_tides
4:54.795 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, rising_tides(2)
4:56.238 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, rising_tides(3)
4:57.663 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
4:59.070 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63945 61714 51450 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63945 61714 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=51450
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Terror : 1352583 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1352583.4 1352583.4 905.3 / 0.067% 285463.9 / 21.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Terror 1352583
Earth Shock 274243 20.3% 48.7 6.02sec 1688187 1579031 Direct 48.7 1175277 3374415 1688150 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.73 48.73 0.00 0.00 1.0691 0.0000 82270653.81 82270653.81 0.00 1579030.63 1579030.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.37 76.68% 1175277.37 685768 1505727 1175221.52 966201 1358809 43916956 43916956 0.00
crit 11.37 23.32% 3374415.22 1969526 4324448 3373302.14 2329804 4231578 38353698 38353698 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 117111 8.7% 11.3 27.13sec 3104922 2961393 Direct 11.3 83610 243290 208954 78.5%  
Periodic 212.1 45982 184151 154493 78.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 212.11 212.11 1.0485 1.4055 35133966.22 35133966.22 0.00 113344.15 2961392.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.43 21.50% 83610.23 74570 91689 82004.19 0 91689 203426 203426 0.00
crit 8.88 78.50% 243290.10 214165 263332 243323.17 232157 254645 2161025 2161025 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.5 21.46% 45982.08 328 50430 45984.66 42175 47898 2093353 2093353 0.00
crit 166.6 78.54% 184150.72 140 202770 184161.59 176483 190368 30676162 30676162 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 352039 (535598) 26.0% (39.6%) 114.9 2.57sec 1398585 1046564 Direct 114.6 0 921380 921380 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.89 114.62 0.00 0.00 1.3364 0.0000 105610486.25 105610486.25 0.00 1046564.48 1046564.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.62 100.00% 921380.43 706066 1086031 919957.01 838362 982549 105610486 105610486 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 167919 12.4% 68.8 4.28sec 732221 0 Direct 68.6 0 734306 734306 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.80 68.60 0.00 0.00 0.0000 0.0000 50375523.36 50375523.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 68.60 100.00% 734305.55 562696 865506 733153.89 663617 782835 50375523 50375523 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 15640 1.2% 85.4 3.27sec 54935 0 Direct 85.4 44189 90147 54935 23.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.41 85.41 0.00 0.00 0.0000 0.0000 4691987.68 4691987.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.44 76.62% 44188.88 42374 47365 44189.75 42867 46041 2891674 2891674 0.00
crit 19.97 23.38% 90147.34 86444 96625 90151.73 86444 96625 1800314 1800314 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 64892 (129005) 4.8% (9.5%) 53.4 5.49sec 724523 539584 Direct 53.4 253092 729327 364464 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.41 53.41 0.00 0.00 1.3428 0.0000 19466735.31 19466735.31 0.00 539583.52 539583.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.92 76.62% 253092.45 147796 545182 256844.37 182876 514475 10357983 10357983 0.00
crit 12.49 23.38% 729326.75 424471 1565762 739251.62 0 1565762 9108752 9108752 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 64113 4.7% 59.9 6.65sec 321003 0 Direct 59.9 223336 641057 321023 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.92 59.92 0.00 0.00 0.0000 0.0000 19233274.06 19233274.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.91 76.62% 223335.59 124149 457953 225784.05 155458 424675 10251984 10251984 0.00
crit 14.01 23.38% 641056.84 356556 1315240 648225.02 377949 1276857 8981290 8981290 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 44261 (64653) 3.3% (4.8%) 3.0 120.44sec 6464728 0 Direct 92.0 116064 236771 144320 23.4%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 92.00 92.00 0.00 0.0000 0.6522 13277295.53 13277295.53 0.00 323236.41 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.47 76.59% 116064.33 116064 116064 116064.33 116064 116064 8178517 8178517 0.00
crit 21.53 23.41% 236771.23 236771 236771 236771.23 236771 236771 5098779 5098779 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 20391 1.5% 36.3 7.39sec 168400 0 Direct 36.3 135409 276235 168399 23.4%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 36.32 0.00 0.00 0.0000 0.0000 6116889.23 6116889.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.81 76.57% 135409.19 135409 135409 135409.19 135409 135409 3766314 3766314 0.00
crit 8.51 23.43% 276234.76 276235 276235 276212.66 0 276235 2350576 2350576 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
Terror From Below 49463 3.7% 9.7 29.70sec 1535301 0 Direct 9.7 1233906 2517168 1535226 23.5%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.67 0.00 0.00 0.0000 0.0000 14839097.55 14839097.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.51% 1233905.72 1233906 1233906 1233905.72 1233906 1233906 9124999 9124999 0.00
crit 2.27 23.49% 2517167.67 2517168 2517168 2282054.80 0 2517168 5714098 5714098 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 225357 / 160074
Fire Blast 194637 10.2% 93.3 3.19sec 444393 214127 Direct 93.3 360148 720309 444397 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.34 93.34 0.00 0.00 2.0754 0.0000 41478714.14 41478714.14 0.00 214126.79 214126.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.50 76.61% 360147.66 343183 383611 360170.15 352513 369811 25752224 25752224 0.00
crit 21.83 23.39% 720309.38 686367 767221 720333.10 694141 752163 15726490 15726490 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 30720 1.6% 10.8 29.00sec 603216 419833 Direct 10.8 106573 213119 131405 23.3%  
Periodic 108.4 38284 76550 47229 23.4% 72.5%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.85 10.85 108.38 108.38 1.4368 2.0067 6544360.08 6544360.08 0.00 28077.50 419833.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.32 76.70% 106572.74 101684 113662 106580.39 102452 113662 886849 886849 0.00
crit 2.53 23.30% 213119.10 203368 227325 200982.42 0 227325 538682 538682 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.0 76.62% 38283.65 13201 42623 38285.23 36914 39972 3179323 3179323 0.00
crit 25.3 23.38% 76550.34 26401 85247 76552.11 66348 82425 1939505 1939505 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 168262 / 22437
Lightning Blast 168262 1.7% 37.0 7.04sec 181905 174090 Direct 37.0 147399 294845 181909 23.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6730483.90 6730483.90 0.00 174089.75 174089.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.34 76.60% 147398.72 141228 157864 147397.04 142951 154665 4177371 4177371 0.00
crit 8.66 23.40% 294845.27 282456 315729 294845.84 282456 315729 2553113 2553113 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Terror
Ascendance 2.0 189.09sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 94.85sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.73sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.50sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.2 0.0 36.6sec 36.6sec 45.21% 61.33% 0.0(0.0) 7.8

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:45.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.22% 32.22% 3.1(3.1) 8.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.5 65.5 4.5sec 2.3sec 72.99% 79.26% 65.5(74.3) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.85%
  • elemental_focus_2:42.15%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.05% 19.13% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.05%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 77.9sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.2sec 16.5sec 47.74% 43.70% 8.8(24.8) 1.2

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.78%
  • power_of_the_maelstrom_2:6.06%
  • power_of_the_maelstrom_3:35.90%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.51% 16.29% 0.0(0.0) 0.4

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.08%
  • stormkeeper_2:3.04%
  • stormkeeper_3:4.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.6sec 100.00% 96.69% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 79.5sec
Lava Surge: During Lava Burst 9.5 28.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7320.0018.8262.4720.00010.409
Fire Elemental0.3940.0011.6860.6220.0003.944
Ascendance9.2550.002104.7059.1310.000104.705
Lava Burst0.8640.00010.0115.5040.00025.131

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Terror
earth_shock Maelstrom 48.7 5181.9 106.3 106.3 15876.5
flame_shock Maelstrom 11.3 207.3 18.3 18.3 169473.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.88 1338.98 (24.57%) 11.66 39.63 2.87%
Lava Burst Overload Maelstrom 68.80 586.12 (10.76%) 8.52 33.07 5.34%
Lightning Bolt Maelstrom 53.42 427.33 (7.84%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 59.92 355.14 (6.52%) 5.93 4.36 1.21%
Aftershock Maelstrom 60.05 1616.77 (29.67%) 26.92 0.00 0.00%
Resonance Totem Maelstrom 298.59 289.02 (5.30%) 0.97 9.57 3.20%
The Deceiver's Blood Pact Maelstrom 9.73 836.16 (15.34%) 85.93 198.85 19.21%
Resource RPS-Gain RPS-Loss
Maelstrom 18.17 17.96
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.58 11.10 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Sentinel + Terror Damage Per Second
Count 24999
Mean 1352583.37
Minimum 1072365.07
Maximum 1672241.78
Spread ( max - min ) 599876.71
Range [ ( max - min ) / 2 * 100% ] 22.18%
Standard Deviation 73028.0301
5th Percentile 1233162.37
95th Percentile 1472511.14
( 95th Percentile - 5th Percentile ) 239348.77
Mean Distribution
Standard Deviation 461.8791
95.00% Confidence Intervall ( 1351678.11 - 1353488.64 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11199
0.1 Scale Factor Error with Delta=300 45526351
0.05 Scale Factor Error with Delta=300 182105404
0.01 Scale Factor Error with Delta=300 4552635082
Priority Target DPS
Sample Data Sentinel + Terror Priority Target Damage Per Second
Count 24999
Mean 1352583.37
Minimum 1072365.07
Maximum 1672241.78
Spread ( max - min ) 599876.71
Range [ ( max - min ) / 2 * 100% ] 22.18%
Standard Deviation 73028.0301
5th Percentile 1233162.37
95th Percentile 1472511.14
( 95th Percentile - 5th Percentile ) 239348.77
Mean Distribution
Standard Deviation 461.8791
95.00% Confidence Intervall ( 1351678.11 - 1353488.64 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11199
0.1 Scale Factor Error with Delta=300 45526351
0.05 Scale Factor Error with Delta=300 182105404
0.01 Scale Factor Error with Delta=300 4552635082
DPS(e)
Sample Data Sentinel + Terror Damage Per Second (Effective)
Count 24999
Mean 1352583.37
Minimum 1072365.07
Maximum 1672241.78
Spread ( max - min ) 599876.71
Range [ ( max - min ) / 2 * 100% ] 22.18%
Damage
Sample Data Sentinel + Terror Damage
Count 24999
Mean 351015909.02
Minimum 276789332.06
Maximum 446672374.94
Spread ( max - min ) 169883042.88
Range [ ( max - min ) / 2 * 100% ] 24.20%
DTPS
Sample Data Sentinel + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.88 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.72 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.23 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 26.32 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.33 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 115.29 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.37 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.42 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.12 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 30.73 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLLILLLLIILLLLLLILLMPNPPQNLLLLLLIILLLLLIJKKKLLILP97GLLLILLLLLIQQQLNMQQQQLNPPPLILOQNQLQQALJLLIMQQQLNLLLLLILLLNPLPNLPMQNQLQNLQQLL9ILLLLHLLIJKKKLFILLLLILLLLLLILPMPNLLLLLILLLNOPPPLILPPNMALPQJNQLQNQQQLNQQ9QLLNQQQLNMPPPLNQQLNLQQNLQQL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.243 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.098 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.952 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.808 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.664 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.803 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.081 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.3/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.220 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.077 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.356 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.495 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.635 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.776 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.632 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.911 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.050 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.187 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.042 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.037 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.155 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.274 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.392 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.508 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.626 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.465 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.745 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.601 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.738 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.595 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.735 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.875 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.016 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.129 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.721 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.201 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.159 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.3/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.637 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.749 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.858 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.339 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.930 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.411 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.893 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.004 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.114 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.226 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.337 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.4/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.933 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.4/125: 91% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:09.022 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.562 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.014 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.125 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.125 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:15.236 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:16.716 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:18.196 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.676 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:20.765 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.854 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.305 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.756 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.846 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.296 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.2/125: 98% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.386 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.838 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.318 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.8/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.769 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:34.219 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.8/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.310 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:36.400 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.9/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:37.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:39.300 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:40.751 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:42.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:43.655 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.770 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.250 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.732 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.214 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.324 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.6/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.436 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.918 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.673 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.153 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.266 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.228 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.709 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.188 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.188 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.300 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.390 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.8/125: 75% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:05.480 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:06.933 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:08.021 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.111 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.201 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.290 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.402 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.882 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.993 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.585 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.1/125: 63% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.546 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.1/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.025 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.1/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.136 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.616 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.728 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.208 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.3/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.319 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.912 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.393 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.507 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.987 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.467 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.578 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.059 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.148 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.601 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.051 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.503 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.591 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.681 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.161 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.752 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.234 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 117.6/125: 94% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.346 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.457 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.939 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.900 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.382 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.493 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.603 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.084 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.196 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.307 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.419 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.528 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.7/125: 73% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.641 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.123 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.123 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.665 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.117 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.568 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.679 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.791 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.903 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.384 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.864 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.344 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.9/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.825 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.9/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.305 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.900 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.351 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.439 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.890 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.981 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.070 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.033 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.514 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.1/125: 86% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.995 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.1/125: 97% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.217 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.698 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:47.149 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.4/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.239 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.995 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.446 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.899 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.379 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.9/125: 69% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.491 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.9/125: 96% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.602 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.083 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.563 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.043 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.6/125: 65% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.154 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.265 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 25.9/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.265 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.9/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.747 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.227 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.707 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.797 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.887 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.978 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.428 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.517 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.631 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.742 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.222 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.704 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.185 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.299 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.780 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.260 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 61.2/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.371 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.851 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.334 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.2/125: 78% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:28.445 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.2/125: 88% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.557 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.036 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.516 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.997 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.479 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.590 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.701 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.8/125: 10% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.180 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.8/125: 17% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.661 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.141 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.621 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.733 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.214 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:47.665 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.755 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.845 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.298 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.750 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.3/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.231 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.342 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.453 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.934 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.416 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Tome : 1356750 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1356749.9 1356749.9 925.0 / 0.068% 293387.7 / 21.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Tome 1356750
Earth Shock 281946 20.8% 48.8 5.98sec 1734848 1622736 Direct 48.8 1235901 3540686 1734861 21.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.76 48.76 0.00 0.00 1.0691 0.0000 84583483.97 84583483.97 0.00 1622735.86 1622735.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.20 78.35% 1235901.30 722982 1578825 1235816.30 1038939 1438584 47213686 47213686 0.00
crit 10.55 21.65% 3540685.95 2076404 4534387 3539631.03 2288804 4387149 37369798 37369798 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 122211 9.0% 11.3 27.16sec 3239697 3090093 Direct 11.3 87977 255924 218310 77.6%  
Periodic 212.1 48396 193984 161202 77.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 212.11 212.11 1.0485 1.4054 36663950.18 36663950.18 0.00 118280.35 3090092.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.53 22.40% 87976.97 78616 96141 86478.64 0 96141 222986 222986 0.00
crit 8.78 77.60% 255924.27 225786 276116 255964.17 244023 267262 2247657 2247657 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.8 22.51% 48396.11 2248 52878 48399.34 44751 50485 2311232 2311232 0.00
crit 164.4 77.49% 193983.92 135 212613 193996.55 186432 200991 31882075 31882075 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13360 1.0% 5.0 60.50sec 801544 0 Periodic 47.0 70599 143940 85272 20.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4007719.16 4007719.16 0.00 66795.32 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 80.00% 70599.49 9957 76542 70601.93 66158 76542 2654411 2654411 0.00
crit 9.4 20.00% 143940.50 20312 156146 143948.28 0 156146 1353308 1353308 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 366324 (557200) 27.0% (41.1%) 114.8 2.59sec 1455719 1089261 Direct 114.6 0 959213 959213 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.83 114.57 0.00 0.00 1.3364 0.0000 109895122.98 109895122.98 0.00 1089260.99 1089260.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.57 100.00% 959213.38 744381 1178876 957746.07 874808 1020140 109895123 109895123 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 174666 12.9% 68.7 4.26sec 762372 0 Direct 68.5 0 764480 764480 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.73 68.54 0.00 0.00 0.0000 0.0000 52398959.68 52398959.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 68.54 100.00% 764480.32 593231 939499 763294.89 689187 815219 52398960 52398960 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16209 1.2% 85.4 3.29sec 56958 0 Direct 85.4 46494 94845 56958 21.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.38 85.38 0.00 0.00 0.0000 0.0000 4862820.11 4862820.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.90 78.36% 46494.26 44674 49665 46494.11 45240 48073 3110442 3110442 0.00
crit 18.48 21.64% 94845.38 91134 101316 94846.52 91134 99749 1752378 1752378 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 66104 (131395) 4.9% (9.7%) 53.4 5.43sec 737601 549240 Direct 53.4 267609 748782 371081 21.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.44 53.44 0.00 0.00 1.3430 0.0000 19830519.49 19830519.49 0.00 549240.46 549240.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.95 78.50% 267608.75 155817 571648 271569.05 198975 480816 11226282 11226282 0.00
crit 11.49 21.50% 748781.60 447505 1641774 759783.27 447505 1641774 8604237 8604237 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 65291 4.8% 60.0 6.56sec 326612 0 Direct 60.0 236051 658164 326610 21.5%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.97 59.97 0.00 0.00 0.0000 0.0000 19586820.50 19586820.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.10 78.55% 236051.00 130886 480185 238621.67 161881 422210 11118777 11118777 0.00
crit 12.87 21.45% 658163.50 375904 1379091 665660.41 0 1332692 8468043 8468043 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 43029 (62867) 3.2% (4.6%) 3.0 120.44sec 6286244 0 Direct 92.0 116064 236771 140300 20.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 92.00 92.00 0.00 0.0000 0.6522 12907796.93 12907796.93 0.00 314312.19 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.53 79.92% 116064.33 116064 116064 116064.33 116064 116064 8533804 8533804 0.00
crit 18.47 20.08% 236771.23 236771 236771 236771.23 236771 236771 4373993 4373993 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19838 1.5% 36.3 7.40sec 163742 0 Direct 36.3 135409 276235 163743 20.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.34 36.34 0.00 0.00 0.0000 0.0000 5950934.19 5950934.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.03 79.88% 135409.19 135409 135409 135409.19 135409 135409 3931113 3931113 0.00
crit 7.31 20.12% 276234.76 276235 276235 276080.06 0 276235 2019821 2019821 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 233967 / 164787
Fire Blast 202064 10.5% 92.6 3.23sec 461269 222369 Direct 92.6 378873 757620 461263 21.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.57 92.57 0.00 0.00 2.0744 0.0000 42698361.95 42698361.95 0.00 222368.77 222368.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.43 78.24% 378872.71 361807 402234 378893.43 370768 388610 27441353 27441353 0.00
crit 20.14 21.76% 757619.81 723613 804468 757652.38 732943 787467 15257009 15257009 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 31903 1.7% 10.8 29.33sec 625423 435356 Direct 10.8 112126 224132 136247 21.5%  
Periodic 107.6 40271 80569 48980 21.6% 72.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.77 10.77 107.61 107.61 1.4366 2.0060 6738880.32 6738880.32 0.00 29129.26 435356.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.45 78.46% 112125.96 107202 119180 112134.60 107202 118029 947934 947934 0.00
crit 2.32 21.54% 224131.72 214404 238361 207411.02 0 238361 520146 520146 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.4 78.39% 40271.44 7443 44693 40273.20 39072 42090 3397051 3397051 0.00
crit 23.3 21.61% 80569.03 27772 89385 80570.17 69086 86940 1873750 1873750 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 172360 / 22983
Lightning Blast 172360 1.7% 37.0 7.04sec 186335 178334 Direct 37.0 155041 310150 186334 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6894397.83 6894397.83 0.00 178334.14 178334.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.54 79.82% 155041.42 148892 165528 155040.82 150427 162169 4579182 4579182 0.00
crit 7.46 20.18% 310149.66 297783 331057 310093.00 0 331057 2315215 2315215 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Tome
Ascendance 2.0 188.67sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 95.59sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1062 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.70sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.66sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.6sec 36.6sec 45.16% 61.31% 0.0(0.0) 7.8

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:45.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.24% 32.24% 3.0(3.0) 8.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.0 64.4 4.6sec 2.3sec 72.15% 78.60% 64.4(72.8) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.72%
  • elemental_focus_2:41.43%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 60.5sec 60.5sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.1sec 13.6sec 8.03% 19.08% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.03%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.98% 29.98% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 78.4sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.2sec 16.5sec 47.79% 43.73% 8.8(25.0) 1.2

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.77%
  • power_of_the_maelstrom_2:6.05%
  • power_of_the_maelstrom_3:35.97%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.52% 16.29% 0.0(0.0) 0.4

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.07%
  • stormkeeper_2:3.05%
  • stormkeeper_3:4.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.6sec 100.00% 96.50% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.6sec
Lava Surge: Wasted 0.8 80.4sec
Lava Surge: During Lava Burst 9.5 28.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7320.0017.3082.4710.00012.698
Fire Elemental0.3830.0011.8660.5880.0003.732
Ascendance9.2260.001108.1709.1280.000108.170
Lava Burst0.8650.0009.3925.5100.00021.187

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Tome
earth_shock Maelstrom 48.8 5182.1 106.3 106.3 16322.3
flame_shock Maelstrom 11.3 207.3 18.3 18.3 176833.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.83 1338.26 (24.56%) 11.65 39.65 2.88%
Lava Burst Overload Maelstrom 68.73 585.59 (10.75%) 8.52 32.98 5.33%
Lightning Bolt Maelstrom 53.44 427.53 (7.84%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 59.97 355.47 (6.52%) 5.93 4.35 1.21%
Aftershock Maelstrom 60.07 1616.82 (29.67%) 26.91 0.00 0.00%
Resonance Totem Maelstrom 298.59 289.04 (5.30%) 0.97 9.55 3.20%
The Deceiver's Blood Pact Maelstrom 9.74 837.09 (15.36%) 85.92 198.55 19.17%
Resource RPS-Gain RPS-Loss
Maelstrom 18.17 17.96
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.60 14.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Sentinel + Tome Damage Per Second
Count 24999
Mean 1356749.93
Minimum 1081376.75
Maximum 1668468.34
Spread ( max - min ) 587091.60
Range [ ( max - min ) / 2 * 100% ] 21.64%
Standard Deviation 74618.8606
5th Percentile 1233728.24
95th Percentile 1479907.69
( 95th Percentile - 5th Percentile ) 246179.45
Mean Distribution
Standard Deviation 471.9406
95.00% Confidence Intervall ( 1355824.94 - 1357674.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11620
0.1 Scale Factor Error with Delta=300 47531432
0.05 Scale Factor Error with Delta=300 190125727
0.01 Scale Factor Error with Delta=300 4753143168
Priority Target DPS
Sample Data Sentinel + Tome Priority Target Damage Per Second
Count 24999
Mean 1356749.93
Minimum 1081376.75
Maximum 1668468.34
Spread ( max - min ) 587091.60
Range [ ( max - min ) / 2 * 100% ] 21.64%
Standard Deviation 74618.8606
5th Percentile 1233728.24
95th Percentile 1479907.69
( 95th Percentile - 5th Percentile ) 246179.45
Mean Distribution
Standard Deviation 471.9406
95.00% Confidence Intervall ( 1355824.94 - 1357674.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 117
0.1% Error 11620
0.1 Scale Factor Error with Delta=300 47531432
0.05 Scale Factor Error with Delta=300 190125727
0.01 Scale Factor Error with Delta=300 4753143168
DPS(e)
Sample Data Sentinel + Tome Damage Per Second (Effective)
Count 24999
Mean 1356749.93
Minimum 1081376.75
Maximum 1668468.34
Spread ( max - min ) 587091.60
Range [ ( max - min ) / 2 * 100% ] 21.64%
Damage
Sample Data Sentinel + Tome Damage
Count 24999
Mean 350688127.17
Minimum 272743858.16
Maximum 442593992.47
Spread ( max - min ) 169850134.31
Range [ ( max - min ) / 2 * 100% ] 24.22%
DTPS
Sample Data Sentinel + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.87 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.74 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.23 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 26.28 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.31 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 115.23 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.35 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.48 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.13 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.66 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 30.74 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQLFLLLILLLLILLLALILLLNPLNPPQLMNLLLLLILLLNLLLLLIIIJLLKKIIKLLG97LLILLLALILLLLIPPNPLLMLLLLIILLLLNOPPPLAJNMLLLLLLLILLLLLAILLLLILLLLMN9LLLLLLILLLLLIHLLJKKKIQLFLLLILLLLLALIILLLLLIIGLILLNNOPLLLNPPQLMNNALLJ9KKKILLNLLLLLILALNNLMPPLNPQQNLLQNQQLNQQLNLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:03.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.246 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.100 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.955 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.812 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.668 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.523 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.379 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.379 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.520 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.658 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.799 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.654 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.510 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.651 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.790 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.930 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.784 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.924 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.064 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.6/125: 65% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.202 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.202 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.342 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.198 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.052 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.191 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.331 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.185 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.325 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.180 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.036 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.174 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.315 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.592 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.6/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.431 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.6/125: 73% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.268 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.9/125: 23% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.384 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.502 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.619 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.736 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.9/125: 79% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.186 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.9/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.275 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.727 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:47.207 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.2/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.689 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.2/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.912 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.392 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.872 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.354 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.836 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.946 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.056 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.169 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.283 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.876 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.987 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.097 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.208 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.320 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.431 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.912 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.392 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.502 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.613 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.613 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:16.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:17.546 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:18.634 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:20.088 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:22.992 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:22.992 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.444 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.534 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.077 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.035 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.2/125: 95% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.124 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.577 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.029 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.120 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.572 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.053 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.164 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.276 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.757 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:44.239 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.6/125: 82% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.6/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:47.200 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.311 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.402 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:53.393 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.483 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.594 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.350 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.832 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.313 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.793 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.273 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.273 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.385 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.497 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.607 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.1/125: 14% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.087 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.567 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.1/125: 34% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.045 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.1/125: 63% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.004 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.1/125: 74% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.484 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.1/125: 85% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.595 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.708 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.188 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.150 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.632 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:24.112 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:25.201 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.654 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:28.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:29.558 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:31.010 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.122 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:33.573 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.023 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:36.476 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:37.928 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:39.016 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:40.104 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:41.193 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.645 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:44.096 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:45.548 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:46.638 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:48.088 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.7/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:49.540 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.079 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.039 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.520 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.001 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.111 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.224 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.704 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.185 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.495 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.604 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.719 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.831 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.944 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.423 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.903 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.903 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.862 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.342 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.415 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.895 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.2/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.2/125: 80% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.436 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.436 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.886 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.975 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.065 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.546 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.026 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.466 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.578 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.689 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.802 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:40.282 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.391 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.503 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:43.984 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.096 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.4/125: 88% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.206 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.961 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:48.441 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.035 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.147 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.1/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.259 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.738 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.219 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.2/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.698 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.2/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.177 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.2/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.290 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.2/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.401 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.3/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.513 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.513 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.994 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.474 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.585 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.696 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.807 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.918 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.029 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.140 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.251 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.732 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.844 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.326 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.919 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.7/125: 65% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.7/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.847 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.7/125: 94% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.938 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.389 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.389 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.841 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.951 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.1/125: 93% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.062 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.174 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.285 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.736 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.188 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.9/125: 61% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.641 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.732 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.183 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:39.636 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:41.087 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:42.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:43.628 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:44.717 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:46.167 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:47.256 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.5/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:48.736 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:50.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.697 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.809 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:54.260 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.710 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:56.800 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.891 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.4/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:59.342 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Terror + Tome : 1350249 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1350249.1 1350249.1 938.8 / 0.070% 296541.5 / 22.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Terror + Tome 1350249
Earth Shock 287094 21.3% 47.6 6.12sec 1808324 1691039 Direct 47.6 1228555 3540001 1808310 25.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.63 47.63 0.00 0.00 1.0694 0.0000 86126311.38 86126311.38 0.00 1691039.08 1691039.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.68 74.92% 1228555.02 722982 1578825 1228477.42 1012370 1427521 43838036 43838036 0.00
crit 11.95 25.08% 3540000.98 2076404 4534387 3539908.74 2513787 4315236 42288275 42288275 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 123881 9.2% 11.3 27.13sec 3282895 3132017 Direct 11.3 88055 255922 220304 78.8%  
Periodic 212.1 48424 193418 163472 79.3% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 212.09 212.09 1.0482 1.4056 37164509.64 37164509.64 0.00 119893.64 3132016.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.40 21.21% 88054.63 78616 96141 86092.14 0 96141 211472 211472 0.00
crit 8.92 78.79% 255921.82 225786 276116 255952.73 244918 267035 2282571 2282571 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.8 20.65% 48423.51 193 52878 48426.53 44739 50359 2121017 2121017 0.00
crit 168.3 79.35% 193417.97 130 212613 193428.14 185373 200315 32549450 32549450 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13763 1.0% 5.2 60.40sec 801448 0 Periodic 47.0 70620 144132 87778 23.3% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.15 0.00 47.03 47.03 0.0000 1.2767 4128585.37 4128585.37 0.00 68752.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.1 76.66% 70619.97 9957 76542 70620.14 66150 76542 2546285 2546285 0.00
crit 11.0 23.34% 144132.00 20312 156146 144138.02 32583 156146 1582300 1582300 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 373343 (546047) 27.6% (40.4%) 114.5 2.59sec 1430579 1070878 Direct 114.2 0 980323 980323 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.51 114.25 0.00 0.00 1.3359 0.0000 112000209.69 112000209.69 0.00 1070877.81 1070877.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.25 100.00% 980322.52 744381 1208916 978845.21 901050 1045602 112000210 112000210 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 156040 11.6% 60.1 4.88sec 779085 0 Direct 59.9 0 781267 781267 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.08 59.92 0.00 0.00 0.0000 0.0000 46810838.81 46810838.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.92 100.00% 781266.53 593231 963439 780071.57 698289 840849 46810839 46810839 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16664 1.2% 85.2 3.36sec 58672 0 Direct 85.2 46483 94837 58671 25.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.20 85.20 0.00 0.00 0.0000 0.0000 4998988.17 4998988.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.72 74.79% 46482.55 44674 49665 46483.25 45010 47989 2962058 2962058 0.00
crit 21.48 25.21% 94837.05 91134 101316 94836.31 91435 99643 2036930 2036930 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 70053 (134542) 5.2% (10.0%) 54.6 5.35sec 739054 549597 Direct 54.6 265331 754963 384817 24.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.61 54.61 0.00 0.00 1.3447 0.0000 21015423.21 21015423.21 0.00 549596.79 549596.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.29 75.60% 265330.70 155817 571648 269103.29 193002 432213 10954861 10954861 0.00
crit 13.33 24.40% 754963.33 447505 1641774 765146.42 466456 1549751 10060562 10060562 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 64489 4.8% 56.9 6.80sec 339972 0 Direct 56.9 234594 667584 339949 24.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.90 56.90 0.00 0.00 0.0000 0.0000 19345865.50 19345865.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.06 75.67% 234593.95 130886 480185 237040.91 155743 430654 10101306 10101306 0.00
crit 13.85 24.33% 667583.73 375904 1379091 674610.28 388434 1325780 9244559 9244559 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 49981 3.7% 9.6 29.56sec 1554620 0 Direct 9.6 1233906 2517168 1554636 25.0%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.64 9.64 0.00 0.00 0.0000 0.0000 14993853.29 14993853.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.23 75.01% 1233905.72 1233906 1233906 1233757.64 0 1233906 8926431 8926431 0.00
crit 2.41 24.99% 2517167.67 2517168 2517168 2321928.33 0 2517168 6067422 6067422 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 239798 / 171301
Fire Blast 207107 11.0% 93.9 3.18sec 472947 227809 Direct 93.9 378699 757569 472950 24.9%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.85 93.85 0.00 0.00 2.0761 0.0000 44386975.17 44386975.17 0.00 227808.93 227808.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.51 75.12% 378698.88 361807 402234 378718.76 371136 388742 26700193 26700193 0.00
crit 23.35 24.88% 757568.87 723613 804468 757616.68 735275 787536 17686783 17686783 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32691 1.7% 10.9 28.95sec 642892 447426 Direct 10.9 112052 224251 140355 25.2%  
Periodic 108.9 40268 80489 50274 24.9% 72.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.89 10.89 108.90 108.90 1.4369 2.0072 7004000.22 7004000.22 0.00 29901.34 447425.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.15 74.77% 112052.31 107202 119180 112055.44 107202 118029 912797 912797 0.00
crit 2.75 25.23% 224250.97 214404 238361 215416.16 0 238361 616314 616314 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.8 75.12% 40268.30 9508 44693 40270.12 38934 42013 3294161 3294161 0.00
crit 27.1 24.88% 80489.39 27772 89385 80492.96 70607 87068 2180728 2180728 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177295 / 23641
Lightning Blast 177295 1.8% 37.0 7.04sec 191671 183441 Direct 37.0 155057 310145 191673 23.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7091816.23 7091816.23 0.00 183440.67 183440.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.27 76.39% 155057.16 148892 165528 155057.34 150551 162154 4382719 4382719 0.00
crit 8.73 23.61% 310145.03 297783 331057 310143.15 0 331057 2709098 2709098 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Terror + Tome
Ascendance 2.0 188.19sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 94.50sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1062 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.70sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.33sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.6sec 36.6sec 44.29% 60.80% 0.0(0.0) 7.8

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:44.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.1sec 32.17% 32.17% 3.0(3.0) 8.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.1 66.6 4.5sec 2.3sec 73.43% 79.39% 66.6(75.8) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.84%
  • elemental_focus_2:42.58%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.2 0.0 60.0sec 60.0sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.01% 19.19% 0.7(0.7) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.01%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 77.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.1sec 16.5sec 47.36% 43.14% 8.8(24.8) 1.2

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.80%
  • power_of_the_maelstrom_2:6.12%
  • power_of_the_maelstrom_3:35.44%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.45% 15.87% 0.0(0.0) 0.4

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.07%
  • stormkeeper_2:3.03%
  • stormkeeper_3:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 96.66% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 81.6sec
Lava Surge: During Lava Burst 9.5 28.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7220.0016.7682.4260.00011.538
Fire Elemental0.4100.0011.8680.6580.0004.012
Ascendance9.1020.001109.3748.9930.000109.374
Lava Burst0.8790.00011.6695.6480.00022.883

Resources

Resource Usage Type Count Total Average RPE APR
Terror + Tome
earth_shock Maelstrom 47.6 5037.4 105.8 105.8 17097.3
flame_shock Maelstrom 11.3 207.4 18.3 18.3 179183.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.50 1336.77 (25.20%) 11.67 37.25 2.71%
Lava Burst Overload Maelstrom 60.08 512.65 (9.66%) 8.53 28.06 5.19%
Lightning Bolt Maelstrom 54.62 436.93 (8.24%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 56.91 337.52 (6.36%) 5.93 3.93 1.15%
Aftershock Maelstrom 58.95 1573.45 (29.66%) 26.69 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.54 (5.46%) 0.97 9.06 3.03%
The Deceiver's Blood Pact Maelstrom 9.54 818.22 (15.42%) 85.76 190.37 18.87%
Resource RPS-Gain RPS-Loss
Maelstrom 17.68 17.48
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.87 10.70 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Terror + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Terror + Tome Damage Per Second
Count 24999
Mean 1350249.13
Minimum 1050298.48
Maximum 1629331.89
Spread ( max - min ) 579033.41
Range [ ( max - min ) / 2 * 100% ] 21.44%
Standard Deviation 75736.9462
5th Percentile 1225958.36
95th Percentile 1474523.29
( 95th Percentile - 5th Percentile ) 248564.93
Mean Distribution
Standard Deviation 479.0121
95.00% Confidence Intervall ( 1349310.29 - 1351187.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12087
0.1 Scale Factor Error with Delta=300 48966521
0.05 Scale Factor Error with Delta=300 195866084
0.01 Scale Factor Error with Delta=300 4896652093
Priority Target DPS
Sample Data Terror + Tome Priority Target Damage Per Second
Count 24999
Mean 1350249.13
Minimum 1050298.48
Maximum 1629331.89
Spread ( max - min ) 579033.41
Range [ ( max - min ) / 2 * 100% ] 21.44%
Standard Deviation 75736.9462
5th Percentile 1225958.36
95th Percentile 1474523.29
( 95th Percentile - 5th Percentile ) 248564.93
Mean Distribution
Standard Deviation 479.0121
95.00% Confidence Intervall ( 1349310.29 - 1351187.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12087
0.1 Scale Factor Error with Delta=300 48966521
0.05 Scale Factor Error with Delta=300 195866084
0.01 Scale Factor Error with Delta=300 4896652093
DPS(e)
Sample Data Terror + Tome Damage Per Second (Effective)
Count 24999
Mean 1350249.13
Minimum 1050298.48
Maximum 1629331.89
Spread ( max - min ) 579033.41
Range [ ( max - min ) / 2 * 100% ] 21.44%
Damage
Sample Data Terror + Tome Damage
Count 24999
Mean 346584585.07
Minimum 266021731.95
Maximum 429173329.04
Spread ( max - min ) 163151597.09
Range [ ( max - min ) / 2 * 100% ] 23.54%
DTPS
Sample Data Terror + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Terror + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Terror + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Terror + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Terror + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Terror + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Terror + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Terror + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.85 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.15 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.65 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.22 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 25.07 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.23 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 114.91 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.46 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.56 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.15 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.95 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 31.71 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLLILLLLILLLLILPPNIPQLNLILLLLLIGLILLLLLILLLLJALIILLKKIKGQ97LNNLQLNLLLLLILLMLLLIILLLNPOLNLLLLLIIAIJKKKLILQGQQLLIIILLLLLLIILLLLILMLL9LLILLNPPHLNLAPJQNQLQFLLLILLLLILLLMNLLLLLLIILLLLLI8IILLPNIMPPLALNJLLL9LLLIIQQQNLLLLLLILLGNQQQLNLLLLLILLLNIP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.247 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.102 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.957 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.810 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.664 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.803 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.943 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.223 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.3/125: 91% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.362 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:14.218 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:15.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:16.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:17.637 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:18.777 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:19.633 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:20.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:21.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:22.764 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:23.903 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:24.759 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:25.897 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.038 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.176 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.015 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.853 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.972 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.207 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.043 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.161 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.017 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.155 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.294 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.571 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.687 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.777 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.955 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.044 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.976 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.458 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.939 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.419 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.530 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.011 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.491 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.971 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.083 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.194 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.194 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.675 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.7/125: 100% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.786 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.897 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.377 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.858 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.969 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.082 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.195 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.305 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.415 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:14.895 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:16.111 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:16.111 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:17.592 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:18.703 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.8/125: 85% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:19.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:20.929 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:22.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.6/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:23.833 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:24.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:26.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.852 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.303 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.756 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.1/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.207 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.1/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.295 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:34.747 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.8/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:36.228 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.339 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.8/125: 55% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.821 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:39.911 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.8/125: 90% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:41.363 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:42.452 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:43.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:44.993 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:46.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:47.953 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.064 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.545 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.298 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.412 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.523 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.635 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.747 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.708 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.819 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.931 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.041 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.041 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.152 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.265 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.378 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.489 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.600 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.712 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.825 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.305 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.787 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.877 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.329 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:16.782 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:17.872 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:19.325 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:20.437 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:21.550 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:22.663 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:24.145 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:25.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:27.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.586 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.067 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.547 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.658 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.769 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.673 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.575 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.663 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.114 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.203 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.107 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.196 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.2/125: 67% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:48.647 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.2/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.126 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.2/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.717 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.198 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.311 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.792 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.271 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.493 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.605 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.084 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.084 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.564 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.674 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.764 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.393 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.482 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.482 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.963 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.444 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.8/125: 89% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.925 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.8/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:17.037 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:18.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:19.999 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:21.480 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:22.962 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:24.074 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:25.553 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:27.033 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:28.512 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.7/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.626 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.7/125: 81% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.698 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.809 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.920 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.400 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.882 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.994 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.586 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.060 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.149 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.905 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.994 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.085 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.567 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.047 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.528 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.639 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.7/125: 98% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.752 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:59.842 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.292 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.745 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.3/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.194 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.194 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.307 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.418 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.528 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.639 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.120 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.600 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.711 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.189 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.7/125: 69% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.671 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.7/125: 87% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.149 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.7/125: 98% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:18.260 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:19.372 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:20.485 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:21.596 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:22.707 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:23.818 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.6/125: 20% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:25.299 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:26.411 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:27.893 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:29.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.852 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.6/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.333 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.423 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.873 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.326 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.416 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.506 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.986 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.466 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.946 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.428 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.539 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.648 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.1/125: 46% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.128 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.607 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.1/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.570 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.681 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.161 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.642 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.753 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.863 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.974 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Terror + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=terror_from_below,id=147016,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Sentinel : 1329998 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1329998.3 1329998.3 899.0 / 0.068% 282499.0 / 21.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Sentinel 1329998
Earth Shock 269588 20.3% 48.8 6.00sec 1658845 1551672 Direct 48.8 1204996 3460808 1658830 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.75 48.75 0.00 0.00 1.0691 0.0000 80874705.95 80874705.95 0.00 1551672.18 1551672.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.95 79.88% 1204996.18 703828 1545380 1204900.44 976247 1388089 46929313 46929313 0.00
crit 9.81 20.12% 3460808.05 2021393 4438331 3459918.18 0 4438331 33945392 33945392 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 118688 8.9% 11.3 27.14sec 3147325 3001494 Direct 11.3 85751 249758 211488 76.7%  
Periodic 212.1 47170 189477 156585 76.9% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 212.11 212.11 1.0486 1.4055 35606728.79 35606728.79 0.00 114868.57 3001494.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.64 23.33% 85751.47 76534 94104 84618.71 0 94104 226363 226363 0.00
crit 8.67 76.67% 249757.58 219805 270267 249803.64 234520 261351 2166299 2166299 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.0 23.11% 47169.51 538 51758 47173.28 43886 49241 2312349 2312349 0.00
crit 163.1 76.89% 189477.01 134 208109 189491.25 180287 196060 30901717 30901717 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 354358 (538893) 26.6% (40.5%) 114.9 2.61sec 1407401 1053159 Direct 114.6 0 927517 927517 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.87 114.61 0.00 0.00 1.3364 0.0000 106304927.20 106304927.20 0.00 1053159.01 1053159.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.61 100.00% 927517.13 724660 1085227 926204.70 849412 981848 106304927 106304927 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 168921 12.7% 68.7 4.35sec 737100 0 Direct 68.6 0 739224 739224 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.75 68.55 0.00 0.00 0.0000 0.0000 50675010.64 50675010.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 68.55 100.00% 739224.36 577514 864866 738153.40 671121 786421 50675011 50675011 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 15614 1.2% 85.5 3.34sec 54815 0 Direct 85.5 45355 92519 54813 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.46 85.46 0.00 0.00 0.0000 0.0000 4684183.10 4684183.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.32 79.94% 45355.05 43490 48613 45356.09 43616 47170 3098533 3098533 0.00
crit 17.14 20.06% 92519.33 88720 99170 92521.66 88720 98098 1585650 1585650 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 63598 (126481) 4.8% (9.5%) 53.4 5.31sec 710365 529006 Direct 53.4 259331 747690 357188 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.41 53.41 0.00 0.00 1.3428 0.0000 19078987.91 19078987.91 0.00 529005.60 529005.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.71 79.96% 259330.91 151688 559539 263232.79 187098 455162 11076327 11076327 0.00
crit 10.70 20.04% 747690.05 435649 1606996 758732.69 0 1606996 8002661 8002661 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 62884 4.7% 59.9 6.42sec 314916 0 Direct 59.9 228678 658440 314917 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.90 59.90 0.00 0.00 0.0000 0.0000 18864467.46 18864467.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.88 79.93% 228677.91 127418 470013 231285.56 153593 372337 10950116 10950116 0.00
crit 12.02 20.07% 658440.20 365945 1349877 665326.19 0 1322520 7914352 7914352 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31471 2.4% 16.2 18.30sec 583314 0 Direct 16.0 487076 993635 588743 20.1%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.18 16.04 0.00 0.00 0.0000 0.0000 9440854.58 9440854.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.82 79.93% 487076.02 487076 487076 487076.02 487076 487076 6242772 6242772 0.00
crit 3.22 20.07% 993635.07 993635 993635 962473.43 0 993635 3198083 3198083 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Spectral Owl 44181 (64520) 3.3% (4.9%) 3.0 120.41sec 6451439 0 Direct 92.0 119121 243007 144060 20.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 92.00 92.00 0.00 0.0000 0.6522 13253369.17 13253369.17 0.00 322571.93 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.48 79.87% 119120.85 119121 119121 119120.85 119121 119121 8753107 8753107 0.00
crit 18.52 20.13% 243006.52 243007 243007 243006.52 243007 243007 4500262 4500262 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 20338 1.5% 36.3 7.38sec 167998 0 Direct 36.3 138975 283509 168001 20.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 36.32 0.00 0.00 0.0000 0.0000 6100946.87 6100946.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.02 79.92% 138975.15 138975 138975 138975.15 138975 138975 4033548 4033548 0.00
crit 7.29 20.08% 283509.31 283509 283509 283316.52 0 283509 2067399 2067399 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 225288 / 157925
Fire Blast 194513 10.3% 92.2 3.25sec 443930 214072 Direct 92.2 369752 739589 443935 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.15 92.15 0.00 0.00 2.0738 0.0000 40908705.45 40908705.45 0.00 214071.87 214071.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.67 79.94% 369751.61 352221 393713 369775.50 361881 380027 27239056 27239056 0.00
crit 18.48 20.06% 739589.26 704442 787426 739641.63 709762 770935 13669650 13669650 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 30774 1.6% 10.7 29.60sec 602888 419721 Direct 10.7 109398 218817 131521 20.2%  
Periodic 107.2 39302 78607 47188 20.1% 71.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.73 10.73 107.19 107.19 1.4365 2.0056 6469579.76 6469579.76 0.00 28079.41 419721.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.56 79.77% 109398.47 104362 116656 109405.90 105307 115710 936512 936512 0.00
crit 2.17 20.23% 218817.31 208724 233311 199481.19 0 233311 474926 474926 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.7 79.94% 39301.82 7765 43746 39304.03 37844 40804 3367631 3367631 0.00
crit 21.5 20.06% 78607.32 27096 87492 78605.48 67723 85837 1690511 1690511 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 168229 / 22432
Lightning Blast 168229 1.7% 37.0 7.04sec 181869 174060 Direct 37.0 151262 302590 181866 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6729162.76 6729162.76 0.00 174060.08 174060.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.52 79.77% 151261.90 144947 162022 151260.78 146786 158191 4464735 4464735 0.00
crit 7.48 20.23% 302590.26 289894 324044 302477.70 0 324044 2264428 2264428 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Sentinel
Ascendance 2.0 188.95sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 96.70sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.99 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.70sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.42sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.2 0.0 36.6sec 36.6sec 45.22% 61.35% 0.0(0.0) 7.8

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:45.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 65.7 63.5 4.6sec 2.3sec 71.49% 78.04% 63.5(71.4) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.59%
  • elemental_focus_2:40.90%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.04% 19.11% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.04%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.02% 30.02% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 78.4sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.2sec 16.5sec 47.75% 43.77% 8.8(24.9) 1.2

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.76%
  • power_of_the_maelstrom_2:6.07%
  • power_of_the_maelstrom_3:35.92%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.11% 16.11% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.49% 16.30% 0.0(0.0) 0.4

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.05%
  • stormkeeper_2:3.05%
  • stormkeeper_3:4.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.6sec 100.00% 96.59% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 81.6sec
Lava Surge: During Lava Burst 9.5 28.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7320.0016.6372.4740.00011.026
Fire Elemental0.3790.0011.6890.5830.0004.238
Ascendance9.4020.001110.9819.2950.000110.981
Lava Burst0.8690.00010.7195.5290.00021.581

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Sentinel
earth_shock Maelstrom 48.8 5183.3 106.3 106.3 15602.9
flame_shock Maelstrom 11.3 207.3 18.3 18.3 171793.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.86 1338.64 (24.56%) 11.65 39.74 2.88%
Lava Burst Overload Maelstrom 68.75 585.61 (10.74%) 8.52 33.13 5.36%
Lightning Bolt Maelstrom 53.42 427.34 (7.84%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 59.90 355.13 (6.51%) 5.93 4.30 1.20%
Aftershock Maelstrom 60.07 1617.18 (29.67%) 26.92 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.01 (5.30%) 0.97 9.58 3.21%
The Deceiver's Blood Pact Maelstrom 9.76 838.40 (15.38%) 85.93 199.16 19.20%
Resource RPS-Gain RPS-Loss
Maelstrom 18.17 17.97
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 61.07 15.20 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Thurible + Sentinel Damage Per Second
Count 24999
Mean 1329998.28
Minimum 1067106.28
Maximum 1601047.68
Spread ( max - min ) 533941.40
Range [ ( max - min ) / 2 * 100% ] 20.07%
Standard Deviation 72521.7403
5th Percentile 1209532.67
95th Percentile 1447478.06
( 95th Percentile - 5th Percentile ) 237945.39
Mean Distribution
Standard Deviation 458.6769
95.00% Confidence Intervall ( 1329099.29 - 1330897.28 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11422
0.1 Scale Factor Error with Delta=300 44897288
0.05 Scale Factor Error with Delta=300 179589151
0.01 Scale Factor Error with Delta=300 4489728752
Priority Target DPS
Sample Data Thurible + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1329998.28
Minimum 1067106.28
Maximum 1601047.68
Spread ( max - min ) 533941.40
Range [ ( max - min ) / 2 * 100% ] 20.07%
Standard Deviation 72521.7403
5th Percentile 1209532.67
95th Percentile 1447478.06
( 95th Percentile - 5th Percentile ) 237945.39
Mean Distribution
Standard Deviation 458.6769
95.00% Confidence Intervall ( 1329099.29 - 1330897.28 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11422
0.1 Scale Factor Error with Delta=300 44897288
0.05 Scale Factor Error with Delta=300 179589151
0.01 Scale Factor Error with Delta=300 4489728752
DPS(e)
Sample Data Thurible + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1329998.28
Minimum 1067106.28
Maximum 1601047.68
Spread ( max - min ) 533941.40
Range [ ( max - min ) / 2 * 100% ] 20.07%
Damage
Sample Data Thurible + Sentinel Damage
Count 24999
Mean 344884181.67
Minimum 270233982.79
Maximum 420600776.30
Spread ( max - min ) 150366793.51
Range [ ( max - min ) / 2 * 100% ] 21.80%
DTPS
Sample Data Thurible + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.87 totem_mastery,if=buff.resonance_totem.remains<2
9 3.99 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.74 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.23 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 26.30 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.32 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 115.27 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.35 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.45 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.13 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.66 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 30.71 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLILLLLILLLLILLLNPLNPPQLNMQQQQLNILPPNLPQNLLLLJKKIKLLLIILGLLLNPPP97LNIILLLLLILLLMLLILLLLLIOPPNNLAJKMQNQLLNNQQLLNLPPNLPNQQQLNMQQQLNQQQLNLLLLLHLILJK9KKILLFLLLILLLLILLLLMNLLLLLILLLNOQQQLNPPPNLLALLIJGKKKLLIQQNQLQNLILLLLIL9GLLNIQLPPLNPQNQLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:03.085 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:04.204 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.043 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.881 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.718 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:07.556 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:07.556 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:08.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:09.836 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.975 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.830 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:14.110 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:15.250 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.6/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:16.390 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.345 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.462 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.697 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:22.535 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:23.652 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:24.490 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.608 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.6/125: 82% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:26.445 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.563 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.418 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.273 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.411 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.549 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:32.689 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:33.830 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:34.684 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.541 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.682 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.822 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.962 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.102 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.241 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.352 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.464 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.575 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.054 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.533 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.644 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.124 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.605 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.087 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.200 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.161 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.641 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.121 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.232 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.344 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:03.456 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:04.568 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:05.679 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.159 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:08.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:09.699 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.789 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.878 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.967 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:14.056 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.508 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:18.049 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.161 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.641 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.123 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.604 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.715 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.715 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:26.196 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:27.307 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:28.419 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.530 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.011 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.084 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.562 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.672 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.783 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.263 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.744 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.856 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:44.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.4/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:45.817 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.4/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:46.907 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:48.358 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:49.448 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:50.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:52.350 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.1/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:53.830 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.1/125: 98% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:54.942 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.696 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.176 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:58.657 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:59.745 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.8/125: 91% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:00.833 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.284 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:02.284 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:03.374 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:04.462 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:05.550 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.641 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.730 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.300 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.411 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.521 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.4/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.634 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.113 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.593 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.184 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.296 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.406 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.886 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.367 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.479 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.961 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.414 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.504 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.954 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:32.406 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
2:33.858 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:35.339 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:36.450 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.561 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.041 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:40.491 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:41.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.393 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.483 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.966 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.446 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.928 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.409 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.520 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.999 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.3/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.440 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.921 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.033 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.515 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.107 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.218 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.330 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.439 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.551 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.6/125: 79% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.639 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.730 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:11.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.271 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.271 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:14.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:17.685 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:18.797 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:20.278 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.758 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.717 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.830 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.054 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.534 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.014 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.124 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.236 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.717 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.168 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.257 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.7/125: 73% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.708 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.7/125: 83% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.162 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.250 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.730 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.269 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.359 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:47.112 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.562 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.044 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.005 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.118 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.599 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.080 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.560 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:59.673 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:01.154 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:02.635 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.635 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.595 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.706 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.818 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.931 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.043 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.156 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.268 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.380 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.860 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.7/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.971 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.451 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:18.903 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:19.994 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.2/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:21.445 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.896 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.2/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.377 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.490 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.602 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.713 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.195 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.677 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.157 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.637 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.749 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.229 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.342 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.454 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.414 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.7/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.526 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.638 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.120 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.209 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.661 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.565 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.6/125: 93% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.656 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.136 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.616 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.729 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.208 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.688 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Terror : 1319855 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1319855.1 1319855.1 913.5 / 0.069% 288317.3 / 21.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.3 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Terror 1319855
Earth Shock 273406 20.7% 47.6 6.12sec 1723282 1611533 Direct 47.6 1199470 3444118 1723238 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.60 47.60 0.00 0.00 1.0694 0.0000 82020608.19 82020608.19 0.00 1611533.48 1611533.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.49 76.67% 1199469.85 703828 1545380 1199325.65 981158 1414593 43767590 43767590 0.00
crit 11.11 23.33% 3444117.72 2021393 4438331 3443415.79 2461650 4282891 38253018 38253018 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120118 9.1% 11.3 27.14sec 3182619 3036118 Direct 11.3 85806 249715 214237 78.4%  
Periodic 212.1 47193 189004 158473 78.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 212.08 212.08 1.0483 1.4056 36035687.74 36035687.74 0.00 116252.78 3036118.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.45 21.65% 85805.78 76534 94104 84238.47 0 94104 210303 210303 0.00
crit 8.87 78.35% 249715.34 219805 270267 249752.91 237221 261691 2215405 2215405 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.7 21.53% 47192.63 202 51758 47195.42 43999 49186 2154656 2154656 0.00
crit 166.4 78.47% 189004.20 264 208109 189016.31 181523 195244 31455323 31455323 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 360050 (526456) 27.3% (39.9%) 114.6 2.59sec 1378135 1031628 Direct 114.3 0 944650 944650 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.60 114.34 0.00 0.00 1.3359 0.0000 108012897.18 108012897.18 0.00 1031627.56 1031627.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.34 100.00% 944650.28 724660 1114631 943205.29 859109 1008370 108012897 108012897 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 150378 11.4% 60.1 4.88sec 750661 0 Direct 59.9 0 752777 752777 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.10 59.93 0.00 0.00 0.0000 0.0000 45112805.25 45112805.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.93 100.00% 752776.74 577514 888299 751597.46 680720 820064 45112805 45112805 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16028 1.2% 85.3 3.33sec 56379 0 Direct 85.3 45354 92524 56379 23.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.28 85.28 0.00 0.00 0.0000 0.0000 4808224.10 4808224.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.35 76.63% 45354.23 43490 48613 45355.20 43873 47234 2963949 2963949 0.00
crit 19.93 23.37% 92523.88 88720 99170 92526.24 88720 98098 1844275 1844275 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 67497 (129762) 5.1% (9.8%) 54.5 5.34sec 713754 530762 Direct 54.5 258265 741939 371272 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.54 54.54 0.00 0.00 1.3448 0.0000 20248782.98 20248782.98 0.00 530762.29 530762.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.80 76.64% 258265.46 151688 559539 261920.49 196286 521421 10794956 10794956 0.00
crit 12.74 23.36% 741939.36 435649 1606996 751967.05 0 1516920 9453827 9453827 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 62265 4.7% 56.8 6.85sec 328574 0 Direct 56.8 228122 657839 328570 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.85 56.85 0.00 0.00 0.0000 0.0000 18678915.95 18678915.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.56 76.62% 228122.05 127418 470013 230449.97 143028 426501 9936781 9936781 0.00
crit 13.29 23.38% 657838.54 365945 1349877 664543.06 385871 1300790 8742135 8742135 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32343 2.5% 16.2 18.40sec 600155 0 Direct 16.0 487076 993635 605828 23.4%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.17 16.02 0.00 0.00 0.0000 0.0000 9702656.33 9702656.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.26 76.56% 487076.02 487076 487076 487076.02 487076 487076 5972083 5972083 0.00
crit 3.75 23.44% 993635.07 993635 993635 975311.71 0 993635 3730573 3730573 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Terror From Below 50643 3.8% 9.6 29.52sec 1575183 0 Direct 9.6 1266400 2583456 1575243 23.4%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.64 9.64 0.00 0.00 0.0000 0.0000 15192555.75 15192555.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.38 76.56% 1266400.24 1266400 1266400 1266400.24 1266400 1266400 9350714 9350714 0.00
crit 2.26 23.44% 2583456.50 2583456 2583456 2341738.64 0 2583456 5841842 5841842 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 231235 / 164089
Fire Blast 199692 10.7% 93.2 3.21sec 455943 219704 Direct 93.2 369643 739394 455950 23.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.25 93.25 0.00 0.00 2.0753 0.0000 42514848.43 42514848.43 0.00 219703.62 219703.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.48 76.66% 369643.14 352221 393713 369667.62 362201 380860 26423008 26423008 0.00
crit 21.76 23.34% 739393.69 704442 787426 739440.58 715081 769340 16091840 16091840 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 31542 1.7% 10.8 29.16sec 619124 430945 Direct 10.8 109379 218810 134892 23.3%  
Periodic 108.3 39291 78585 48482 23.4% 72.4%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.84 10.84 108.29 108.29 1.4367 2.0066 6712835.86 6712835.86 0.00 28826.17 430945.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 76.68% 109378.60 104362 116656 109382.81 104362 114764 909344 909344 0.00
crit 2.53 23.32% 218810.49 208724 233311 206538.03 0 233311 553305 553305 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.0 76.61% 39290.82 13548 43746 39292.92 37939 40977 3259486 3259486 0.00
crit 25.3 23.39% 78584.77 27096 87492 78591.02 69300 84999 1990701 1990701 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 172771 / 23038
Lightning Blast 172771 1.7% 37.0 7.04sec 186780 178760 Direct 37.0 151282 302639 186776 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6910843.79 6910843.79 0.00 178759.54 178759.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.32 76.55% 151282.50 144947 162022 151282.93 146786 158504 4284776 4284776 0.00
crit 8.68 23.45% 302639.08 289894 324044 302642.15 0 324044 2626068 2626068 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Terror
Ascendance 2.0 189.28sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 95.39sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1062 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.72sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.51sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.2 0.0 36.6sec 36.6sec 44.31% 60.81% 0.0(0.0) 7.8

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:44.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.25% 32.25% 3.0(3.0) 8.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 65.9 65.8 4.6sec 2.3sec 72.98% 79.04% 65.8(74.6) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.81%
  • elemental_focus_2:42.17%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.00% 19.18% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.00%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.00% 30.00% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 77.9sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.1sec 16.5sec 47.35% 43.11% 8.8(24.8) 1.2

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.78%
  • power_of_the_maelstrom_2:6.11%
  • power_of_the_maelstrom_3:35.47%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.09% 16.09% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.45% 15.91% 0.0(0.0) 0.4

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.08%
  • stormkeeper_2:3.02%
  • stormkeeper_3:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 96.29% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 78.8sec
Lava Surge: During Lava Burst 9.4 28.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7270.0017.5682.4510.00010.623
Fire Elemental0.3930.0011.4810.6200.0003.917
Ascendance9.0590.001111.8438.9650.000111.843
Lava Burst0.8770.00010.0065.6680.00023.628

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Terror
earth_shock Maelstrom 47.6 5034.0 105.8 105.8 16293.2
flame_shock Maelstrom 11.3 207.5 18.3 18.3 173704.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.60 1337.95 (25.24%) 11.68 37.24 2.71%
Lava Burst Overload Maelstrom 60.10 512.82 (9.67%) 8.53 28.08 5.19%
Lightning Bolt Maelstrom 54.54 436.32 (8.23%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 56.85 337.17 (6.36%) 5.93 3.93 1.15%
Aftershock Maelstrom 58.92 1572.44 (29.66%) 26.69 0.00 0.00%
Resonance Totem Maelstrom 298.59 289.56 (5.46%) 0.97 9.03 3.03%
The Deceiver's Blood Pact Maelstrom 9.50 815.05 (15.37%) 85.81 189.67 18.88%
Resource RPS-Gain RPS-Loss
Maelstrom 17.67 17.47
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 61.71 10.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Thurible + Terror Damage Per Second
Count 24999
Mean 1319855.06
Minimum 1052137.36
Maximum 1605091.66
Spread ( max - min ) 552954.30
Range [ ( max - min ) / 2 * 100% ] 20.95%
Standard Deviation 73689.1986
5th Percentile 1198056.01
95th Percentile 1440455.90
( 95th Percentile - 5th Percentile ) 242399.89
Mean Distribution
Standard Deviation 466.0607
95.00% Confidence Intervall ( 1318941.59 - 1320768.52 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11975
0.1 Scale Factor Error with Delta=300 46354440
0.05 Scale Factor Error with Delta=300 185417759
0.01 Scale Factor Error with Delta=300 4635443961
Priority Target DPS
Sample Data Thurible + Terror Priority Target Damage Per Second
Count 24999
Mean 1319855.06
Minimum 1052137.36
Maximum 1605091.66
Spread ( max - min ) 552954.30
Range [ ( max - min ) / 2 * 100% ] 20.95%
Standard Deviation 73689.1986
5th Percentile 1198056.01
95th Percentile 1440455.90
( 95th Percentile - 5th Percentile ) 242399.89
Mean Distribution
Standard Deviation 466.0607
95.00% Confidence Intervall ( 1318941.59 - 1320768.52 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11975
0.1 Scale Factor Error with Delta=300 46354440
0.05 Scale Factor Error with Delta=300 185417759
0.01 Scale Factor Error with Delta=300 4635443961
DPS(e)
Sample Data Thurible + Terror Damage Per Second (Effective)
Count 24999
Mean 1319855.06
Minimum 1052137.36
Maximum 1605091.66
Spread ( max - min ) 552954.30
Range [ ( max - min ) / 2 * 100% ] 20.95%
Damage
Sample Data Thurible + Terror Damage
Count 24999
Mean 339813133.48
Minimum 267762030.44
Maximum 418171171.52
Spread ( max - min ) 150409141.08
Range [ ( max - min ) / 2 * 100% ] 22.13%
DTPS
Sample Data Thurible + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.86 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 3.64 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.21 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 25.08 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 8.24 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 115.01 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 5.46 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 22.52 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.14 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 14.88 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 31.69 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPPPEKKKKHKKKKKHKKKKKHKKKKHKKKKKKHKKKKFKHKKKKKKHHHKKIMKKK97KKHFKKPMPPPKKMPPPKMPLPPKPMKKKKKHKKMNOOOMKIKLPMPKPMPPPKMMPPKMKPPMPKPLKKKKHHK9KPMPPKPGMPPIKPMKKKKKKHHKKGKKKKKEHKKKKHKKKKHKKKKHK8KKKKFHHKIJJJKHKKKK9MOKLOKMHKKKKKHHKKKKKKHKKMOLOOKMP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.969 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:03.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:04.247 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.102 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.956 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.813 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:07.670 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:07.670 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:08.809 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:09.948 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.086 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.202 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:13.040 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:14.158 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:15.276 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:16.393 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.3/125: 83% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:17.509 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.3/125: 93% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.648 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.503 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.358 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.497 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.635 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.490 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.628 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:25.482 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:26.622 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:27.762 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.901 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.040 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.896 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.036 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.174 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.028 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.167 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.306 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.161 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.016 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.155 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:40.297 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:41.436 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:42.917 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.029 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.509 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.598 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.049 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.502 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:50.954 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:52.406 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.9/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:53.857 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.9/125: 83% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.968 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.080 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.190 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.299 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.409 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.890 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.980 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.070 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.522 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom ascendance, lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.613 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.065 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.154 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 92.7/125: 74% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.154 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.7/125: 74% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:09.604 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.7/125: 85% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:11.054 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:12.143 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:13.255 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:14.737 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:16.217 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:17.328 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:18.439 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:19.921 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:21.400 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:22.879 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:24.360 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:25.473 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:26.585 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.4/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.066 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.546 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.026 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.507 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.618 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.099 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.9/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.210 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.171 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.649 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.129 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.9/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.239 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.720 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:46.169 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:47.621 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:49.072 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.162 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.253 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:52.734 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:54.214 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.325 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.079 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.560 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.040 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.522 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.634 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.747 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.857 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.338 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.451 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.563 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.674 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:09.785 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:11.266 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.376 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.487 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:14.967 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.449 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.929 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.410 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:20.499 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:21.591 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:23.043 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:24.495 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:25.585 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.676 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.127 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.577 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.057 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.169 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.651 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.131 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.610 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.723 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.205 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.686 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.169 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.650 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.4/125: 97% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.761 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.872 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.351 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.463 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.946 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.427 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.537 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.017 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.498 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.978 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:58.457 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:59.567 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:00.679 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.160 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:03.641 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:04.965 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:06.446 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.558 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.670 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.151 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom ascendance, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.632 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:13.113 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:14.593 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:16.045 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.4/125: 92% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.495 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.585 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:19.673 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:21.124 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.606 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.718 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.198 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.678 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.158 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.638 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.092 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.092 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:32.181 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:33.632 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.084 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.535 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.015 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.127 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.606 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.088 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.570 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.050 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.161 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.274 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.755 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.235 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.716 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:52.827 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:54.307 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:55.061 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.540 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.019 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.499 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.980 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.090 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.202 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.291 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.743 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.833 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.923 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.011 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.100 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.211 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.322 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.800 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.910 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.393 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.874 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.985 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.096 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.576 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.666 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.756 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:25.209 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:26.660 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.1/125: 71% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:27.749 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.839 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.318 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.799 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.280 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.761 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.871 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.984 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:38.094 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:39.205 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:40.656 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.559 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.011 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.462 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.054 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.534 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:51.645 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:53.126 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:54.237 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.716 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.198 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:58.678 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.7/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:59.788 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Tome : 1326464 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1326463.9 1326463.9 923.3 / 0.070% 291486.6 / 22.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Tome 1326464
Earth Shock 281631 21.2% 47.6 6.12sec 1773867 1658857 Direct 47.6 1259346 3631421 1773932 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.63 47.63 0.00 0.00 1.0693 0.0000 84488888.54 84488888.54 0.00 1658856.68 1658856.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.30 78.31% 1259345.89 742021 1620403 1259207.93 1038412 1463817 46971700 46971700 0.00
crit 10.33 21.69% 3631420.84 2131086 4653798 3630847.58 2498002 4467646 37517189 37517189 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 125625 9.5% 11.3 27.14sec 3330860 3177745 Direct 11.3 90296 262720 223416 77.2%  
Periodic 212.1 49675 199006 165776 77.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 212.10 212.10 1.0482 1.4056 37688060.68 37688060.68 0.00 121583.80 3177745.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.58 22.79% 90296.29 80687 98672 89112.92 0 98672 232887 232887 0.00
crit 8.74 77.21% 262719.95 231732 283387 262759.78 248547 274301 2295040 2295040 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.2 22.25% 49674.84 202 54271 49678.24 45852 51840 2344602 2344602 0.00
crit 164.9 77.75% 199006.22 532 218212 199018.82 190714 205762 32815531 32815531 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13746 1.0% 5.2 60.41sec 800557 0 Periodic 47.0 72473 147998 87669 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.15 0.00 47.04 47.04 0.0000 1.2767 4123576.21 4123576.21 0.00 68667.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.88% 72472.59 10219 78558 72473.55 67725 78558 2722867 2722867 0.00
crit 9.5 20.12% 147997.98 20847 160258 148001.30 20847 160258 1400709 1400709 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 375495 (548816) 28.3% (41.4%) 114.4 2.58sec 1439447 1077575 Direct 114.1 0 987093 987093 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.38 114.12 0.00 0.00 1.3358 0.0000 112647215.44 112647215.44 0.00 1077574.74 1077574.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.12 100.00% 987092.57 763985 1209921 985727.19 910746 1050262 112647215 112647215 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 156708 11.8% 59.9 4.86sec 784475 0 Direct 59.8 0 786756 786756 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.93 59.75 0.00 0.00 0.0000 0.0000 47011917.32 47011917.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.75 100.00% 786755.95 608853 964240 785661.34 692202 837638 47011917 47011917 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 16612 1.3% 85.0 3.28sec 58596 0 Direct 85.0 47712 97349 58595 21.9%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.05 85.05 0.00 0.00 0.0000 0.0000 4983511.09 4983511.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.40 78.07% 47711.60 45850 50972 47712.02 46338 49308 3168083 3168083 0.00
crit 18.65 21.93% 97349.09 93534 103984 97348.55 93534 102038 1815428 1815428 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 68902 (132104) 5.2% (10.0%) 54.7 5.39sec 723921 538249 Direct 54.7 271738 770232 377592 21.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.74 54.74 0.00 0.00 1.3450 0.0000 20669706.92 20669706.92 0.00 538248.65 538248.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.12 78.77% 271738.31 159920 586703 275516.77 204485 487956 11716884 11716884 0.00
crit 11.62 21.23% 770232.33 459290 1685010 780509.00 459290 1652442 8952822 8952822 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 63202 4.8% 56.9 6.86sec 333133 0 Direct 56.9 240114 682663 333115 21.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.91 56.91 0.00 0.00 0.0000 0.0000 18959387.83 18959387.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.95 78.98% 240113.84 134333 492830 242565.22 161336 425939 10793007 10793007 0.00
crit 11.96 21.02% 682663.47 385804 1415408 689101.74 0 1366166 8166381 8166381 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31841 2.4% 16.2 18.40sec 590898 0 Direct 16.0 487076 993635 596651 21.6%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.17 16.01 0.00 0.00 0.0000 0.0000 9552108.75 9552108.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.55 78.37% 487076.02 487076 487076 487076.02 487076 487076 6111490 6111490 0.00
crit 3.46 21.63% 993635.07 993635 993635 969468.90 0 993635 3440619 3440619 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 239798 / 169093
Fire Blast 207033 11.0% 92.7 3.21sec 472636 227834 Direct 92.7 388823 777787 472628 21.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.67 92.67 0.00 0.00 2.0745 0.0000 43799695.54 43799695.54 0.00 227833.88 227833.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.70 78.45% 388823.49 371335 412826 388847.08 380186 400529 28268590 28268590 0.00
crit 19.97 21.55% 777787.16 742669 825653 777841.73 752825 811822 15531105 15531105 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32765 1.7% 10.8 29.17sec 642327 447103 Direct 10.8 115040 230214 140460 22.1%  
Periodic 107.7 41345 82611 50263 21.6% 72.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 107.71 107.71 1.4367 2.0061 6929209.61 6929209.61 0.00 29921.19 447103.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 77.92% 115039.94 110025 122319 115046.04 110025 121531 967044 967044 0.00
crit 2.38 22.08% 230214.48 220050 244638 214945.32 0 244638 548256 548256 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.4 78.39% 41344.86 14252 45870 41347.22 40036 43164 3491006 3491006 0.00
crit 23.3 21.61% 82611.19 28503 91739 82614.55 71126 89194 1922904 1922904 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177047 / 23608
Lightning Blast 177047 1.8% 37.0 7.04sec 191402 183179 Direct 37.0 159130 318275 191402 20.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7081883.36 7081883.36 0.00 183179.00 183179.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.50 79.72% 159129.93 152813 169887 159130.29 154758 166336 4693865 4693865 0.00
crit 7.50 20.28% 318274.52 305625 339775 318200.28 0 339775 2388019 2388019 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Tome
Ascendance 2.0 189.94sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 95.27sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.75sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.81sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.6sec 36.6sec 44.17% 60.71% 0.0(0.0) 7.8

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:44.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.26% 32.26% 3.1(3.1) 8.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 65.4 64.4 4.6sec 2.3sec 71.98% 78.17% 64.4(72.7) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.62%
  • elemental_focus_2:41.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.2 0.0 60.0sec 60.0sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.1sec 13.5sec 8.00% 19.18% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.00%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.03% 30.03% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 78.2sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.7 35.2sec 16.5sec 47.16% 42.87% 8.7(24.7) 1.2

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.76%
  • power_of_the_maelstrom_2:6.07%
  • power_of_the_maelstrom_3:35.33%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.09% 16.09% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.44% 15.81% 0.0(0.0) 0.4

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.06%
  • stormkeeper_2:3.02%
  • stormkeeper_3:4.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 96.60% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 79.4sec
Lava Surge: During Lava Burst 9.4 28.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7260.0017.4692.4500.0009.793
Fire Elemental0.3920.0011.4800.6130.0003.891
Ascendance9.0010.001111.1938.9060.000111.193
Lava Burst0.8730.0009.9085.6360.00022.395

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Tome
earth_shock Maelstrom 47.6 5035.4 105.7 105.7 16779.1
flame_shock Maelstrom 11.3 207.3 18.3 18.3 181807.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.38 1335.41 (25.18%) 11.67 37.18 2.71%
Lava Burst Overload Maelstrom 59.93 511.28 (9.64%) 8.53 28.07 5.21%
Lightning Bolt Maelstrom 54.74 437.92 (8.26%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 56.91 337.50 (6.36%) 5.93 3.94 1.15%
Aftershock Maelstrom 58.94 1572.80 (29.66%) 26.68 0.00 0.00%
Resonance Totem Maelstrom 298.59 289.54 (5.46%) 0.97 9.05 3.03%
The Deceiver's Blood Pact Maelstrom 9.54 818.12 (15.43%) 85.79 190.50 18.89%
Resource RPS-Gain RPS-Loss
Maelstrom 17.68 17.48
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.24 14.10 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Thurible + Tome Damage Per Second
Count 24999
Mean 1326463.91
Minimum 1051110.05
Maximum 1635740.43
Spread ( max - min ) 584630.39
Range [ ( max - min ) / 2 * 100% ] 22.04%
Standard Deviation 74484.2588
5th Percentile 1202839.55
95th Percentile 1448615.53
( 95th Percentile - 5th Percentile ) 245775.97
Mean Distribution
Standard Deviation 471.0892
95.00% Confidence Intervall ( 1325540.59 - 1327387.23 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12113
0.1 Scale Factor Error with Delta=300 47360107
0.05 Scale Factor Error with Delta=300 189440426
0.01 Scale Factor Error with Delta=300 4736010645
Priority Target DPS
Sample Data Thurible + Tome Priority Target Damage Per Second
Count 24999
Mean 1326463.91
Minimum 1051110.05
Maximum 1635740.43
Spread ( max - min ) 584630.39
Range [ ( max - min ) / 2 * 100% ] 22.04%
Standard Deviation 74484.2588
5th Percentile 1202839.55
95th Percentile 1448615.53
( 95th Percentile - 5th Percentile ) 245775.97
Mean Distribution
Standard Deviation 471.0892
95.00% Confidence Intervall ( 1325540.59 - 1327387.23 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12113
0.1 Scale Factor Error with Delta=300 47360107
0.05 Scale Factor Error with Delta=300 189440426
0.01 Scale Factor Error with Delta=300 4736010645
DPS(e)
Sample Data Thurible + Tome Damage Per Second (Effective)
Count 24999
Mean 1326463.91
Minimum 1051110.05
Maximum 1635740.43
Spread ( max - min ) 584630.39
Range [ ( max - min ) / 2 * 100% ] 22.04%
Damage
Sample Data Thurible + Tome Damage
Count 24999
Mean 340124372.77
Minimum 268259621.73
Maximum 426661271.25
Spread ( max - min ) 158401649.52
Range [ ( max - min ) / 2 * 100% ] 23.29%
DTPS
Sample Data Thurible + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.85 totem_mastery,if=buff.resonance_totem.remains<2
9 4.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.15 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 3.65 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.21 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 25.03 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 8.22 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 114.79 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 5.45 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 22.60 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.15 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 14.86 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 31.93 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLLILLLLIPPPLNQLPPNPQMQLNQQQNLQQLNQLLNQJALQLNMQQQQLNPPPLLIIPPLL97NIPQLNMNQQLPNLPONLPQNLQLAJNQQQLNMQQQLNQQQQLNQQQNLLLLLLIMLLLNQQQQLNIQHQLALJNLLLLL9IKKKLLLIHLFLLLLLIILLLLLLIILL8LLNMQQQLNNAQQJQLNQQQQLNQQQNLPMLLLLILLLLIPPQL9NQQQLNMLP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.968 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:03.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:04.247 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.103 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.958 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.813 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.668 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.668 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.947 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.229 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.084 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.223 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:15.362 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:16.501 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:17.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:18.779 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:19.634 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:20.751 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:21.870 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:22.986 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.8/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:24.101 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.8/125: 94% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:24.938 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:26.055 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:27.193 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.332 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.186 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.9/125: 88% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.039 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.179 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.320 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.6/125: 45% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.460 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.601 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.455 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.595 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.734 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.590 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.729 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.868 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.723 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.204 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.685 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:46.166 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:47.278 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:48.757 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.237 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:51.718 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:52.830 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.4/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:53.942 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.421 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.510 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.962 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:59.051 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:00.503 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.9/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
1:01.593 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.593 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.705 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.9/125: 53% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.300 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.412 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.522 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.6/125: 17% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.633 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.744 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.225 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.184 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:15.296 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:16.775 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:18.255 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:19.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:21.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.6/125: 78% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:22.331 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:23.443 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
1:24.553 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
1:26.032 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:27.512 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.623 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.104 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:31.216 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:31.216 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:32.329 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.441 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.921 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:36.403 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:37.883 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:38.972 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:40.062 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.1/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.151 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:42.601 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:44.052 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:45.503 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:46.952 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.061 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.173 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.654 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.410 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.522 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.005 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.485 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.966 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:58.058 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.4/125: 25% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:59.149 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.601 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.053 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.053 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.143 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.231 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.343 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.454 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.565 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.045 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.157 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.268 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.749 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.231 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:15.713 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:17.193 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:18.305 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:19.788 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:21.270 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, potion_of_prolonged_power
2:22.749 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, potion_of_prolonged_power
2:24.230 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:25.681 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:26.771 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.221 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:29.673 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:31.123 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:32.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.6/125: 45% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.226 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.707 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.187 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.6/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.669 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.780 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.891 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.461 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.912 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.001 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.452 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.902 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:52.354 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.804 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.285 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.2/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:56.397 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:57.508 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:58.988 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.099 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.581 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.693 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.693 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.174 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.286 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom ascendance, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:09.355 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:10.837 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.319 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.432 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.543 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.655 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:16.743 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:17.833 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:18.923 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:20.012 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.4/125: 83% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:21.102 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.4/125: 93% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:22.213 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:23.323 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:24.434 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:25.915 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:25.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:27.395 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.876 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.836 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.317 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.428 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.020 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.502 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.983 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.573 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.052 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.163 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.274 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.755 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:49.206 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:49.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:51.410 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.861 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.950 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.063 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.544 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.025 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.987 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:02.098 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:03.209 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:03.209 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:04.688 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.168 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.278 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.389 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.872 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.984 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.098 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.190 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.642 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.092 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:17.545 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:18.634 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:20.088 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:21.540 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw
4:22.991 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
4:24.103 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:25.584 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:27.063 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:28.175 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.4/125: 44% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.133 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.612 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.4/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.094 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:35.206 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:36.687 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:38.166 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.277 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.758 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.8/125: 94% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:41.867 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:43.346 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.826 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.306 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.787 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 102.9/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.899 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.9/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.009 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.489 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.970 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.449 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.930 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.021 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:58.111 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.4/125: 11% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:59.199 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1169496 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1169496.2 1169496.2 847.1 / 0.072% 266731.4 / 22.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.3 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1169496
Earth Shock 254847 21.8% 47.6 6.10sec 1605687 1501589 Direct 47.6 1167742 3348631 1605677 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.61 47.61 0.00 0.00 1.0693 0.0000 76453422.48 76453422.48 0.00 1501589.36 1501589.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.05 79.92% 1167742.39 685768 1505727 1167630.77 941186 1378723 44435633 44435633 0.00
crit 9.56 20.08% 3348631.25 1969526 4324448 3348358.06 0 4324448 32017789 32017789 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 115582 9.9% 11.3 27.12sec 3065153 2924197 Direct 11.3 83560 243411 206024 76.6%  
Periodic 212.1 45963 184641 152510 76.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 11.31 212.09 212.09 1.0482 1.4056 34675133.84 34675133.84 0.00 111866.46 2924197.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.65 23.39% 83560.05 74570 91689 82513.57 0 91689 221086 221086 0.00
crit 8.67 76.61% 243411.19 214165 263332 243455.94 231180 254976 2109622 2109622 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.1 23.17% 45962.98 183 50430 45966.41 42370 48096 2258845 2258845 0.00
crit 162.9 76.83% 184641.24 492 202770 184656.25 176474 192216 30085581 30085581 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 343914 (502694) 29.4% (43.0%) 114.5 2.60sec 1316757 985533 Direct 114.3 0 902882 902882 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.53 114.27 0.00 0.00 1.3361 0.0000 103172152.70 103172152.70 0.00 985532.97 985532.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.27 100.00% 902881.68 706066 1057381 901608.42 833632 962861 103172153 103172153 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 143616 12.3% 60.0 4.87sec 717515 0 Direct 59.9 0 719562 719562 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.05 59.88 0.00 0.00 0.0000 0.0000 43084308.35 43084308.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.88 100.00% 719562.46 562696 842674 718524.19 656348 771632 43084308 43084308 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 15163 1.3% 85.2 3.31sec 53413 0 Direct 85.2 44190 90151 53414 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.16 85.16 0.00 0.00 0.0000 0.0000 4548808.80 4548808.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.07 79.93% 44189.77 42374 47365 44189.80 42827 45895 3008069 3008069 0.00
crit 17.09 20.07% 90151.36 86444 96625 90147.89 0 95320 1540740 1540740 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 62907 (120838) 5.4% (10.3%) 54.6 5.31sec 663946 493712 Direct 54.6 250979 722974 345663 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.60 54.60 0.00 0.00 1.3448 0.0000 18871518.79 18871518.79 0.00 493711.67 493711.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.65 79.94% 250978.98 147796 545182 254529.60 192534 425824 10954152 10954152 0.00
crit 10.95 20.06% 722973.91 424471 1565762 732678.96 0 1565762 7917367 7917367 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 57930 5.0% 56.9 6.78sec 305664 0 Direct 56.9 221937 638775 305673 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.86 56.86 0.00 0.00 0.0000 0.0000 17378766.77 17378766.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.43 79.91% 221936.77 124149 457953 224245.74 143136 375891 10083036 10083036 0.00
crit 11.42 20.09% 638775.04 356556 1315240 645141.62 356556 1251268 7295731 7295731 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 219490 / 153682
Fire Blast 189502 11.3% 92.0 3.24sec 432491 208565 Direct 92.0 360300 720677 432492 20.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.04 92.04 0.00 0.00 2.0737 0.0000 39808239.06 39808239.06 0.00 208565.33 208565.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.61 79.97% 360299.98 343183 383611 360326.06 351463 371411 26520119 26520119 0.00
crit 18.44 20.03% 720677.07 686367 767221 720725.72 691550 757114 13288120 13288120 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 29989 1.8% 10.7 29.49sec 587191 408779 Direct 10.7 106609 213195 128023 20.1%  
Periodic 107.1 38295 76591 45985 20.1% 71.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 10.72 107.08 107.08 1.4365 2.0055 6297246.23 6297246.23 0.00 27359.82 408779.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.57 79.91% 106608.74 101684 113662 106616.49 101684 112346 913623 913623 0.00
crit 2.15 20.09% 213195.30 203368 227325 194257.37 0 227325 459334 459334 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.6 79.92% 38295.14 7075 42623 38297.11 37075 40045 3277279 3277279 0.00
crit 21.5 20.08% 76591.27 26401 85247 76595.33 66535 82586 1647011 1647011 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 163889 / 21854
Lightning Blast 163889 1.9% 37.0 7.04sec 177177 169565 Direct 37.0 147404 294889 177175 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6555564.60 6555564.60 0.00 169565.31 169565.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.53 79.81% 147404.31 141228 157864 147404.84 142721 154641 4352970 4352970 0.00
crit 7.47 20.19% 294889.38 282456 315729 294783.11 0 315729 2202595 2202595 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 189.38sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 96.24sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.99 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.74sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 115.81sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 8.1 0.0 36.6sec 36.6sec 44.31% 60.82% 0.0(0.0) 7.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:44.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.0 35.1sec 25.0sec 32.27% 32.27% 3.0(3.0) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 65.1 63.7 4.6sec 2.3sec 71.43% 77.75% 63.7(71.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:30.56%
  • elemental_focus_2:40.87%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.4 0.7 14.1sec 13.6sec 7.98% 19.13% 0.7(0.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.8 4.2 23.2sec 17.2sec 29.88% 29.88% 4.2(4.2) 12.5

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 78.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 8.8 35.1sec 16.5sec 47.39% 43.05% 8.8(24.8) 1.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.76%
  • power_of_the_maelstrom_2:6.09%
  • power_of_the_maelstrom_3:35.54%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 115.5sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.43% 15.89% 0.0(0.0) 0.4

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.07%
  • stormkeeper_2:3.03%
  • stormkeeper_3:4.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 115.5sec 100.00% 96.19% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.1 13.6sec
Lava Surge: Wasted 0.8 82.8sec
Lava Surge: During Lava Burst 9.4 28.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.7250.0017.4222.4450.00010.396
Fire Elemental0.3830.0011.4800.5870.0003.847
Ascendance9.0270.001107.3538.9230.000107.353
Lava Burst0.8720.0009.7525.6000.00022.703

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 47.6 5035.1 105.7 105.7 15184.0
flame_shock Maelstrom 11.3 207.2 18.3 18.3 167311.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 114.53 1337.05 (25.22%) 11.67 37.33 2.72%
Lava Burst Overload Maelstrom 60.05 512.48 (9.67%) 8.53 27.96 5.17%
Lightning Bolt Maelstrom 54.59 436.76 (8.24%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 56.85 337.17 (6.36%) 5.93 3.93 1.15%
Aftershock Maelstrom 58.93 1572.71 (29.66%) 26.69 0.00 0.00%
Resonance Totem Maelstrom 298.60 289.56 (5.46%) 0.97 9.04 3.03%
The Deceiver's Blood Pact Maelstrom 9.52 816.50 (15.40%) 85.78 189.70 18.85%
Resource RPS-Gain RPS-Loss
Maelstrom 17.67 17.47
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.68 14.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data baseline Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data baseline Damage Per Second
Count 24999
Mean 1169496.18
Minimum 929515.77
Maximum 1439365.73
Spread ( max - min ) 509849.96
Range [ ( max - min ) / 2 * 100% ] 21.80%
Standard Deviation 68336.2764
5th Percentile 1056900.86
95th Percentile 1282028.62
( 95th Percentile - 5th Percentile ) 225127.76
Mean Distribution
Standard Deviation 432.2052
95.00% Confidence Intervall ( 1168649.07 - 1170343.29 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 132
0.1% Error 13116
0.1 Scale Factor Error with Delta=300 39864498
0.05 Scale Factor Error with Delta=300 159457989
0.01 Scale Factor Error with Delta=300 3986449712
Priority Target DPS
Sample Data baseline Priority Target Damage Per Second
Count 24999
Mean 1169496.18
Minimum 929515.77
Maximum 1439365.73
Spread ( max - min ) 509849.96
Range [ ( max - min ) / 2 * 100% ] 21.80%
Standard Deviation 68336.2764
5th Percentile 1056900.86
95th Percentile 1282028.62
( 95th Percentile - 5th Percentile ) 225127.76
Mean Distribution
Standard Deviation 432.2052
95.00% Confidence Intervall ( 1168649.07 - 1170343.29 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 132
0.1% Error 13116
0.1 Scale Factor Error with Delta=300 39864498
0.05 Scale Factor Error with Delta=300 159457989
0.01 Scale Factor Error with Delta=300 3986449712
DPS(e)
Sample Data baseline Damage Per Second (Effective)
Count 24999
Mean 1169496.18
Minimum 929515.77
Maximum 1439365.73
Spread ( max - min ) 509849.96
Range [ ( max - min ) / 2 * 100% ] 21.80%
Damage
Sample Data baseline Damage
Count 24999
Mean 298184111.71
Minimum 231524562.32
Maximum 370701428.29
Spread ( max - min ) 139176865.96
Range [ ( max - min ) / 2 * 100% ] 23.34%
DTPS
Sample Data baseline Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data baseline Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data baseline Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data baseline Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data baseline Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data baselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.85 totem_mastery,if=buff.resonance_totem.remains<2
9 3.99 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 3.66 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.21 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 25.04 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 8.22 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 114.93 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 5.44 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 22.57 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.15 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 14.89 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 31.76 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKJGJJKEKKKKHKKKKHKKKKKKHOOKMKKKKKHKKKKLMOOOMKHKKKKKKHIJJJKKHHKKFK97KKKKHKKKKKHKKKKKHKLOOOKMPKMNPKPKMPIKJJJKKHLOOOKMKKKKKHKKKKHKKKKK9FMPPKKMKKKKKKGKHIKJJJKHKKEKKHKKKKKHKKKKKKHKFKKKKKKHKK8KMOOOKKHKIKKFK9JHJJKKMOOMMKOPMHKKLOKMOKOMHPPKMPPPMKPL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.106 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.961 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.816 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.3/125: 12% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.670 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.526 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.666 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.666 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.806 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.944 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.083 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.3/125: 88% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.223 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.079 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.934 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.075 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.193 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.032 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.872 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.989 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.107 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.224 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.341 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.457 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.576 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.415 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.533 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.672 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom bloodlust, lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.528 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.384 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.523 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.661 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.517 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.6/125: 75% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.657 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.6/125: 85% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.796 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.652 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.794 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.936 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.076 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.216 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.071 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.182 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.661 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.141 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.622 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.732 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.9/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.215 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.327 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.808 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.289 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.742 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.194 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.646 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:59.098 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.188 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.301 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.391 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.482 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.572 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.025 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.475 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.588 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.700 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.789 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.240 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.329 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:14.420 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.510 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.510 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:16.991 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:18.472 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.952 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.404 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:22.493 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.945 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.395 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.846 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.298 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.751 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.841 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.322 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.804 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.283 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.763 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.4/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.243 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.4/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:39.356 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:40.838 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:41.950 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:43.430 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.6/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:44.884 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:46.335 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:47.787 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.6/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.876 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.326 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.8/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.438 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.550 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.305 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.786 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.267 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.746 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.857 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.8/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.969 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.450 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.562 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.673 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.785 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.897 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.008 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.8/125: 81% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.118 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.8/125: 91% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.598 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.710 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.822 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.302 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.784 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.264 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.745 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:18.835 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:20.288 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:21.738 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.827 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:24.278 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.8/125: 87% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.759 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:26.871 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.351 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.830 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:31.310 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.790 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.901 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.379 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.861 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.343 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.825 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.2/125: 73% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.937 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 104.2/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.049 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.161 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.2/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.273 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.754 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.235 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.715 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.826 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.938 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.050 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.533 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.015 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.466 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.918 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.369 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.460 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.913 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.004 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.091 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.183 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.271 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.361 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.449 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.930 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.040 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.522 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.002 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.002 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.483 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.964 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.074 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.555 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:21.006 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.458 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:23.909 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.2/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.361 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.2/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.451 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.931 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.383 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.834 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.924 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.8/125: 81% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.375 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.8/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.827 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.938 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.419 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.532 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.013 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.493 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.973 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.454 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.935 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.416 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.527 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.007 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.119 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.873 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.353 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.465 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.946 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.425 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.904 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.356 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.9/125: 92% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.447 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.536 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.987 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.178 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.658 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.139 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.250 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.730 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.840 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.952 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.062 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.172 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.284 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.396 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.847 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.936 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.387 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.840 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.952 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.8/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.063 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.543 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.025 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.506 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.617 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.4/125: 96% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.729 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.841 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.323 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.4/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.411 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.862 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.951 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.040 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:40.492 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.973 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.453 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.565 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.678 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.157 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.638 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.120 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.232 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.712 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.192 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.674 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.786 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.267 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.747 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 940.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.86
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 25063
Threads: 64
Confidence: 95.00%
Fight Length (fixed time): 295 - 305 ( 300.0 )

Performance:

Total Events Processed: 827637652
Max Event Queue: 382
Sim Seconds: 7518864
CPU Seconds: 1595.0525
Physical Seconds: 30.9667
Speed Up: 4714

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Charm + Sentinel Charm + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.65sec 0 300.00sec
Charm + Sentinel Charm + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel earth_shock 8042 84636240 282122 9.99 1230913 3536249 50.0 50.0 20.1% 0.0% 0.0% 0.0% 5.85sec 84636240 300.00sec
Charm + Sentinel Charm + Sentinel fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 93.54sec 0 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock 188389 2485359 8285 2.26 87671 254667 11.3 11.3 79.0% 0.0% 0.0% 0.0% 27.12sec 38141614 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock ticks -188389 35656254 118854 43.54 48201 193832 11.3 217.7 79.4% 0.0% 0.0% 0.0% 27.12sec 38141614 300.00sec
Charm + Sentinel Charm + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst 51505 112632171 375442 23.73 0 949211 119.0 118.7 100.0% 0.0% 0.0% 0.0% 2.50sec 112632171 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst_overload 77451 53713382 179045 14.20 0 756508 71.2 71.0 100.0% 0.0% 0.0% 0.0% 4.15sec 53713382 300.00sec
Charm + Sentinel Charm + Sentinel volcanic_inferno 205533 4947849 16493 17.69 46290 94446 88.5 88.5 20.0% 0.0% 0.0% 0.0% 3.19sec 4947849 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt 188196 19644752 65483 10.80 263965 759616 54.0 54.0 20.2% 0.0% 0.0% 0.0% 5.38sec 19644752 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt_overload 45284 19408802 64696 12.11 233106 669714 60.5 60.5 20.0% 0.0% 0.0% 0.0% 6.52sec 19408802 300.00sec
Charm + Sentinel Charm + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel spectral_owl 242570 12890369 42968 18.38 116064 236771 3.0 91.9 20.0% 0.0% 0.0% 0.0% 120.47sec 12890369 300.00sec
Charm + Sentinel Charm + Sentinel spectral_blast 246442 5907098 19690 7.22 135409 276235 36.1 36.1 20.1% 0.0% 0.0% 0.0% 7.38sec 5907098 300.00sec
Charm + Sentinel Charm + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.70sec 0 300.00sec
Charm + Sentinel Charm + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.52sec 0 300.00sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental fire_blast 57984 44784664 205549 27.26 376997 754055 99.0 99.0 20.0% 0.0% 0.0% 0.0% 3.02sec 44784664 217.88sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate 118297 1480776 6796 3.04 111560 223151 11.0 11.0 20.1% 0.0% 0.0% 0.0% 28.51sec 6968787 217.88sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate ticks -118297 5488011 18293 22.79 40107 80229 11.0 114.0 20.0% 0.0% 0.0% 0.0% 28.51sec 6968787 217.88sec
Charm + Sentinel Charm + Sentinel_greater_lightning_elemental lightning_blast 191726 6896991 172425 55.81 154329 308714 37.2 37.2 20.1% 0.0% 0.0% 0.0% 7.00sec 6896991 40.00sec
Charm + Terror Charm + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.04sec 0 300.00sec
Charm + Terror Charm + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror earth_shock 8042 86001958 286675 9.77 1224573 3520125 48.9 48.9 23.3% 0.0% 0.0% 0.0% 5.97sec 86001958 300.00sec
Charm + Terror Charm + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 92.59sec 0 300.00sec
Charm + Terror Charm + Terror flame_shock 188389 2511674 8372 2.26 87716 254665 11.3 11.3 80.5% 0.0% 0.0% 0.0% 27.16sec 38592867 300.00sec
Charm + Terror Charm + Terror flame_shock ticks -188389 36081194 120271 43.60 48219 193405 11.3 218.0 80.8% 0.0% 0.0% 0.0% 27.16sec 38592867 300.00sec
Charm + Terror Charm + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror lava_burst 51505 114593736 381981 23.70 0 967183 118.7 118.5 100.0% 0.0% 0.0% 0.0% 2.52sec 114593736 300.00sec
Charm + Terror Charm + Terror lava_burst_overload 77451 47876168 159588 12.42 0 770780 62.3 62.1 100.0% 0.0% 0.0% 0.0% 4.76sec 47876168 300.00sec
Charm + Terror Charm + Terror volcanic_inferno 205533 5081288 16938 17.66 46300 94448 88.3 88.3 23.4% 0.0% 0.0% 0.0% 3.24sec 5081288 300.00sec
Charm + Terror Charm + Terror lightning_bolt 188196 20899370 69665 11.08 262218 754586 55.4 55.4 23.4% 0.0% 0.0% 0.0% 5.17sec 20899370 300.00sec
Charm + Terror Charm + Terror lightning_bolt_overload 45284 19192882 63977 11.50 232119 667490 57.5 57.5 23.3% 0.0% 0.0% 0.0% 6.62sec 19192882 300.00sec
Charm + Terror Charm + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.71sec 0 300.00sec
Charm + Terror Charm + Terror terror_from_below 242524 15265691 50886 1.99 1233906 2517168 10.0 10.0 23.3% 0.0% 0.0% 0.0% 29.63sec 15265691 300.00sec
Charm + Terror Charm + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.55sec 0 300.00sec
Charm + Terror Charm + Terror_primal_fire_elemental fire_blast 57984 46600558 211748 27.32 376912 753826 100.2 100.2 23.4% 0.0% 0.0% 0.0% 2.98sec 46600558 220.08sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate 118297 1532976 6966 3.04 111544 223176 11.1 11.1 23.4% 0.0% 0.0% 0.0% 28.29sec 7227565 220.08sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate ticks -118297 5694588 18982 23.04 40073 80145 11.1 115.2 23.4% 0.0% 0.0% 0.0% 28.29sec 7227565 220.08sec
Charm + Terror Charm + Terror_greater_lightning_elemental lightning_blast 191726 7087789 177195 55.80 154311 308713 37.2 37.2 23.5% 0.0% 0.0% 0.0% 7.00sec 7087789 40.00sec
Charm + Thurible Charm + Thurible ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.06sec 0 300.00sec
Charm + Thurible Charm + Thurible augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible earth_shock 8042 84369632 281233 9.78 1255987 3604221 48.9 48.9 20.0% 0.0% 0.0% 0.0% 5.98sec 84369632 300.00sec
Charm + Thurible Charm + Thurible fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 93.77sec 0 300.00sec
Charm + Thurible Charm + Thurible flame_shock 188389 2544630 8482 2.26 89967 261414 11.3 11.3 78.8% 0.0% 0.0% 0.0% 27.16sec 39172152 300.00sec
Charm + Thurible Charm + Thurible flame_shock ticks -188389 36627522 122092 43.60 49469 198963 11.3 218.0 79.3% 0.0% 0.0% 0.0% 27.16sec 39172152 300.00sec
Charm + Thurible Charm + Thurible flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible lava_burst 51505 115283787 384281 23.69 0 973263 118.7 118.5 100.0% 0.0% 0.0% 0.0% 2.52sec 115283787 300.00sec
Charm + Thurible Charm + Thurible lava_burst_overload 77451 48205902 160687 12.43 0 775647 62.3 62.1 100.0% 0.0% 0.0% 0.0% 4.76sec 48205902 300.00sec
Charm + Thurible Charm + Thurible volcanic_inferno 205533 5067507 16892 17.66 47514 96927 88.3 88.3 20.0% 0.0% 0.0% 0.0% 3.19sec 5067507 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt 188196 20484706 68283 11.08 268605 772385 55.4 55.4 20.1% 0.0% 0.0% 0.0% 5.13sec 20484706 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt_overload 45284 18877109 62924 11.52 237882 684440 57.6 57.6 20.1% 0.0% 0.0% 0.0% 6.55sec 18877109 300.00sec
Charm + Thurible Charm + Thurible piercing_anguish 246751 9693503 32312 3.29 487076 993635 16.6 16.5 20.1% 0.0% 0.0% 0.0% 17.95sec 9693503 300.00sec
Charm + Thurible Charm + Thurible potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.68sec 0 300.00sec
Charm + Thurible Charm + Thurible totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.42sec 0 300.00sec
Charm + Thurible Charm + Thurible_primal_fire_elemental fire_blast 57984 46030095 211599 27.33 386942 773903 99.1 99.1 20.1% 0.0% 0.0% 0.0% 3.02sec 46030095 217.53sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate 118297 1516618 6972 3.04 114500 229034 11.0 11.0 20.1% 0.0% 0.0% 0.0% 28.65sec 7150866 217.53sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate ticks -118297 5634248 18781 22.81 41138 82267 11.0 114.1 20.1% 0.0% 0.0% 0.0% 28.65sec 7150866 217.53sec
Charm + Thurible Charm + Thurible_greater_lightning_elemental lightning_blast 191726 7081319 177033 55.79 158403 316873 37.2 37.2 20.2% 0.0% 0.0% 0.0% 7.00sec 7081319 40.00sec
Charm + Tome Charm + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.18sec 0 300.00sec
Charm + Tome Charm + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome earth_shock 8042 87715823 292387 9.72 1285435 3682153 48.6 48.6 21.7% 0.0% 0.0% 0.0% 6.01sec 87715823 300.00sec
Charm + Tome Charm + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 92.79sec 0 300.00sec
Charm + Tome Charm + Tome flame_shock 188389 2626731 8756 2.27 92080 267269 11.3 11.3 79.8% 0.0% 0.0% 0.0% 27.13sec 40042318 300.00sec
Charm + Tome Charm + Tome flame_shock ticks -188389 37415587 124719 43.36 50647 203166 11.3 216.8 79.9% 0.0% 0.0% 0.0% 27.13sec 40042318 300.00sec
Charm + Tome Charm + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome insidious_corruption ticks -243941 4009052 13364 9.40 70589 143971 5.0 47.0 20.0% 0.0% 0.0% 0.0% 63.16sec 4009052 300.00sec
Charm + Tome Charm + Tome lava_burst 51505 118063050 393545 23.54 0 1003175 118.0 117.7 100.0% 0.0% 0.0% 0.0% 2.52sec 118063050 300.00sec
Charm + Tome Charm + Tome lava_burst_overload 77451 49295673 164320 12.33 0 799470 61.8 61.7 100.0% 0.0% 0.0% 0.0% 4.76sec 49295673 300.00sec
Charm + Tome Charm + Tome volcanic_inferno 205533 5222444 17408 17.55 48594 99137 87.8 87.8 21.6% 0.0% 0.0% 0.0% 3.21sec 5222444 300.00sec
Charm + Tome Charm + Tome lightning_bolt 188196 21178322 70595 11.01 277131 774672 55.1 55.1 21.6% 0.0% 0.0% 0.0% 5.27sec 21178322 300.00sec
Charm + Tome Charm + Tome lightning_bolt_overload 45284 19443169 64811 11.47 245190 683196 57.3 57.3 21.4% 0.0% 0.0% 0.0% 6.69sec 19443169 300.00sec
Charm + Tome Charm + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.00sec
Charm + Tome Charm + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.73sec 0 300.00sec
Charm + Tome Charm + Tome_primal_fire_elemental fire_blast 57984 47513123 217201 27.11 395636 791314 98.8 98.8 21.5% 0.0% 0.0% 0.0% 3.02sec 47513123 218.75sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate 118297 1577330 7211 3.04 117082 234147 11.1 11.1 21.4% 0.0% 0.0% 0.0% 28.40sec 7394001 218.75sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate ticks -118297 5816670 19389 22.74 42101 84212 11.1 113.7 21.5% 0.0% 0.0% 0.0% 28.40sec 7394001 218.75sec
Charm + Tome Charm + Tome_greater_lightning_elemental lightning_blast 191726 7200679 180017 55.50 162012 324102 37.0 37.0 20.1% 0.0% 0.0% 0.0% 7.03sec 7200679 40.00sec
Sentinel + Terror Sentinel + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.09sec 0 300.00sec
Sentinel + Terror Sentinel + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror earth_shock 8042 82270654 274237 9.75 1175277 3374415 48.7 48.7 23.3% 0.0% 0.0% 0.0% 6.02sec 82270654 300.00sec
Sentinel + Terror Sentinel + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 94.85sec 0 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock 188389 2364451 7882 2.26 83610 243290 11.3 11.3 78.5% 0.0% 0.0% 0.0% 27.13sec 35133966 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock ticks -188389 32769515 109232 42.42 45982 184151 11.3 212.1 78.5% 0.0% 0.0% 0.0% 27.13sec 35133966 300.00sec
Sentinel + Terror Sentinel + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst 51505 105610486 352037 22.92 0 921380 114.9 114.6 100.0% 0.0% 0.0% 0.0% 2.57sec 105610486 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst_overload 77451 50375523 167919 13.72 0 734306 68.8 68.6 100.0% 0.0% 0.0% 0.0% 4.28sec 50375523 300.00sec
Sentinel + Terror Sentinel + Terror volcanic_inferno 205533 4691988 15640 17.08 44189 90147 85.4 85.4 23.4% 0.0% 0.0% 0.0% 3.27sec 4691988 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt 188196 19466735 64889 10.68 253092 729327 53.4 53.4 23.4% 0.0% 0.0% 0.0% 5.49sec 19466735 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt_overload 45284 19233274 64111 11.98 223336 641057 59.9 59.9 23.4% 0.0% 0.0% 0.0% 6.65sec 19233274 300.00sec
Sentinel + Terror Sentinel + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror spectral_owl 242570 13277296 44258 18.40 116064 236771 3.0 92.0 23.4% 0.0% 0.0% 0.0% 120.44sec 13277296 300.00sec
Sentinel + Terror Sentinel + Terror spectral_blast 246442 6116889 20390 7.26 135409 276235 36.3 36.3 23.4% 0.0% 0.0% 0.0% 7.39sec 6116889 300.00sec
Sentinel + Terror Sentinel + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.73sec 0 300.00sec
Sentinel + Terror Sentinel + Terror terror_from_below 242524 14839098 49464 1.93 1233906 2517168 9.7 9.7 23.5% 0.0% 0.0% 0.0% 29.70sec 14839098 300.00sec
Sentinel + Terror Sentinel + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.50sec 0 300.00sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental fire_blast 57984 41478714 194610 26.28 360148 720309 93.3 93.3 23.4% 0.0% 0.0% 0.0% 3.19sec 41478714 213.14sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate 118297 1425531 6688 3.05 106573 213119 10.8 10.8 23.3% 0.0% 0.0% 0.0% 29.00sec 6544360 213.14sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate ticks -118297 5118829 17063 21.68 38284 76550 10.8 108.4 23.4% 0.0% 0.0% 0.0% 29.00sec 6544360 213.14sec
Sentinel + Terror Sentinel + Terror_greater_lightning_elemental lightning_blast 191726 6730484 168262 55.50 147399 294845 37.0 37.0 23.4% 0.0% 0.0% 0.0% 7.04sec 6730484 40.00sec
Sentinel + Tome Sentinel + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.67sec 0 300.00sec
Sentinel + Tome Sentinel + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome earth_shock 8042 84583484 281946 9.75 1235901 3540686 48.8 48.8 21.6% 0.0% 0.0% 0.0% 5.98sec 84583484 300.00sec
Sentinel + Tome Sentinel + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 95.59sec 0 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock 188389 2470643 8236 2.26 87977 255924 11.3 11.3 77.6% 0.0% 0.0% 0.0% 27.16sec 36663950 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock ticks -188389 34193307 113978 42.42 48396 193984 11.3 212.1 77.5% 0.0% 0.0% 0.0% 27.16sec 36663950 300.00sec
Sentinel + Tome Sentinel + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome insidious_corruption ticks -243941 4007719 13359 9.40 70599 143940 5.0 47.0 20.0% 0.0% 0.0% 0.0% 60.50sec 4007719 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst 51505 109895123 366319 22.91 0 959213 114.8 114.6 100.0% 0.0% 0.0% 0.0% 2.59sec 109895123 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst_overload 77451 52398960 174664 13.71 0 764480 68.7 68.5 100.0% 0.0% 0.0% 0.0% 4.26sec 52398960 300.00sec
Sentinel + Tome Sentinel + Tome volcanic_inferno 205533 4862820 16209 17.08 46494 94845 85.4 85.4 21.6% 0.0% 0.0% 0.0% 3.29sec 4862820 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt 188196 19830519 66102 10.69 267609 748782 53.4 53.4 21.5% 0.0% 0.0% 0.0% 5.43sec 19830519 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt_overload 45284 19586820 65290 11.99 236051 658164 60.0 60.0 21.5% 0.0% 0.0% 0.0% 6.56sec 19586820 300.00sec
Sentinel + Tome Sentinel + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome spectral_owl 242570 12907797 43026 18.40 116064 236771 3.0 92.0 20.1% 0.0% 0.0% 0.0% 120.44sec 12907797 300.00sec
Sentinel + Tome Sentinel + Tome spectral_blast 246442 5950934 19837 7.27 135409 276235 36.3 36.3 20.1% 0.0% 0.0% 0.0% 7.40sec 5950934 300.00sec
Sentinel + Tome Sentinel + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.70sec 0 300.00sec
Sentinel + Tome Sentinel + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.66sec 0 300.00sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental fire_blast 57984 42698362 202040 26.28 378873 757620 92.6 92.6 21.8% 0.0% 0.0% 0.0% 3.23sec 42698362 211.34sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate 118297 1468080 6947 3.06 112126 224132 10.8 10.8 21.5% 0.0% 0.0% 0.0% 29.33sec 6738880 211.34sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate ticks -118297 5270801 17569 21.52 40271 80569 10.8 107.6 21.6% 0.0% 0.0% 0.0% 29.33sec 6738880 211.34sec
Sentinel + Tome Sentinel + Tome_greater_lightning_elemental lightning_blast 191726 6894398 172360 55.50 155041 310150 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.04sec 6894398 40.00sec
Terror + Tome Terror + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.19sec 0 300.00sec
Terror + Tome Terror + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome earth_shock 8042 86126311 287089 9.53 1228555 3540001 47.6 47.6 25.1% 0.0% 0.0% 0.0% 6.12sec 86126311 300.00sec
Terror + Tome Terror + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 94.50sec 0 300.00sec
Terror + Tome Terror + Tome flame_shock 188389 2494043 8314 2.26 88055 255922 11.3 11.3 78.8% 0.0% 0.0% 0.0% 27.13sec 37164510 300.00sec
Terror + Tome Terror + Tome flame_shock ticks -188389 34670466 115568 42.42 48424 193418 11.3 212.1 79.3% 0.0% 0.0% 0.0% 27.13sec 37164510 300.00sec
Terror + Tome Terror + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome insidious_corruption ticks -243941 4128585 13762 9.41 70620 144132 5.2 47.0 23.3% 0.0% 0.0% 0.0% 60.40sec 4128585 300.00sec
Terror + Tome Terror + Tome lava_burst 51505 112000210 373336 22.85 0 980323 114.5 114.2 100.0% 0.0% 0.0% 0.0% 2.59sec 112000210 300.00sec
Terror + Tome Terror + Tome lava_burst_overload 77451 46810839 156037 11.98 0 781267 60.1 59.9 100.0% 0.0% 0.0% 0.0% 4.88sec 46810839 300.00sec
Terror + Tome Terror + Tome volcanic_inferno 205533 4998988 16663 17.04 46483 94837 85.2 85.2 25.2% 0.0% 0.0% 0.0% 3.36sec 4998988 300.00sec
Terror + Tome Terror + Tome lightning_bolt 188196 21015423 70052 10.92 265331 754963 54.6 54.6 24.4% 0.0% 0.0% 0.0% 5.35sec 21015423 300.00sec
Terror + Tome Terror + Tome lightning_bolt_overload 45284 19345866 64487 11.38 234594 667584 56.9 56.9 24.3% 0.0% 0.0% 0.0% 6.80sec 19345866 300.00sec
Terror + Tome Terror + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.70sec 0 300.00sec
Terror + Tome Terror + Tome terror_from_below 242524 14993853 49980 1.93 1233906 2517168 9.6 9.6 25.0% 0.0% 0.0% 0.0% 29.56sec 14993853 300.00sec
Terror + Tome Terror + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.33sec 0 300.00sec
Terror + Tome Terror + Tome_primal_fire_elemental fire_blast 57984 44386975 207088 26.27 378699 757569 93.9 93.9 24.9% 0.0% 0.0% 0.0% 3.18sec 44386975 214.34sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate 118297 1529111 7134 3.05 112052 224251 10.9 10.9 25.2% 0.0% 0.0% 0.0% 28.95sec 7004000 214.34sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate ticks -118297 5474889 18250 21.78 40268 80489 10.9 108.9 24.9% 0.0% 0.0% 0.0% 28.95sec 7004000 214.34sec
Terror + Tome Terror + Tome_greater_lightning_elemental lightning_blast 191726 7091816 177295 55.50 155057 310145 37.0 37.0 23.6% 0.0% 0.0% 0.0% 7.04sec 7091816 40.00sec
Thurible + Sentinel Thurible + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.95sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel earth_shock 8042 80874706 269584 9.75 1204996 3460808 48.8 48.8 20.1% 0.0% 0.0% 0.0% 6.00sec 80874706 300.00sec
Thurible + Sentinel Thurible + Sentinel fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 96.70sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock 188389 2392663 7976 2.26 85751 249758 11.3 11.3 76.7% 0.0% 0.0% 0.0% 27.14sec 35606729 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock ticks -188389 33214066 110714 42.42 47170 189477 11.3 212.1 76.9% 0.0% 0.0% 0.0% 27.14sec 35606729 300.00sec
Thurible + Sentinel Thurible + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst 51505 106304927 354351 22.92 0 927517 114.9 114.6 100.0% 0.0% 0.0% 0.0% 2.61sec 106304927 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst_overload 77451 50675011 168918 13.71 0 739224 68.7 68.6 100.0% 0.0% 0.0% 0.0% 4.35sec 50675011 300.00sec
Thurible + Sentinel Thurible + Sentinel volcanic_inferno 205533 4684183 15614 17.09 45355 92519 85.5 85.5 20.1% 0.0% 0.0% 0.0% 3.34sec 4684183 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt 188196 19078988 63597 10.68 259331 747690 53.4 53.4 20.0% 0.0% 0.0% 0.0% 5.31sec 19078988 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt_overload 45284 18864467 62882 11.98 228678 658440 59.9 59.9 20.1% 0.0% 0.0% 0.0% 6.42sec 18864467 300.00sec
Thurible + Sentinel Thurible + Sentinel piercing_anguish 246751 9440855 31470 3.21 487076 993635 16.2 16.0 20.1% 0.0% 0.0% 0.0% 18.30sec 9440855 300.00sec
Thurible + Sentinel Thurible + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_owl 242570 13253369 44178 18.40 119121 243007 3.0 92.0 20.1% 0.0% 0.0% 0.0% 120.41sec 13253369 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_blast 246442 6100947 20337 7.26 138975 283509 36.3 36.3 20.1% 0.0% 0.0% 0.0% 7.38sec 6100947 300.00sec
Thurible + Sentinel Thurible + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.70sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.42sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental fire_blast 57984 40908705 194488 26.29 369752 739589 92.2 92.2 20.1% 0.0% 0.0% 0.0% 3.25sec 40908705 210.34sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate 118297 1411438 6710 3.06 109398 218817 10.7 10.7 20.2% 0.0% 0.0% 0.0% 29.60sec 6469580 210.34sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate ticks -118297 5058142 16860 21.44 39302 78607 10.7 107.2 20.1% 0.0% 0.0% 0.0% 29.60sec 6469580 210.34sec
Thurible + Sentinel Thurible + Sentinel_greater_lightning_elemental lightning_blast 191726 6729163 168229 55.50 151262 302590 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.04sec 6729163 40.00sec
Thurible + Terror Thurible + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.28sec 0 300.00sec
Thurible + Terror Thurible + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror earth_shock 8042 82020608 273403 9.52 1199470 3444118 47.6 47.6 23.3% 0.0% 0.0% 0.0% 6.12sec 82020608 300.00sec
Thurible + Terror Thurible + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 95.39sec 0 300.00sec
Thurible + Terror Thurible + Terror flame_shock 188389 2425708 8086 2.26 85806 249715 11.3 11.3 78.4% 0.0% 0.0% 0.0% 27.14sec 36035688 300.00sec
Thurible + Terror Thurible + Terror flame_shock ticks -188389 33609980 112033 42.42 47193 189004 11.3 212.1 78.5% 0.0% 0.0% 0.0% 27.14sec 36035688 300.00sec
Thurible + Terror Thurible + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror lava_burst 51505 108012897 360045 22.87 0 944650 114.6 114.3 100.0% 0.0% 0.0% 0.0% 2.59sec 108012897 300.00sec
Thurible + Terror Thurible + Terror lava_burst_overload 77451 45112805 150377 11.99 0 752777 60.1 59.9 100.0% 0.0% 0.0% 0.0% 4.88sec 45112805 300.00sec
Thurible + Terror Thurible + Terror volcanic_inferno 205533 4808224 16027 17.06 45354 92524 85.3 85.3 23.4% 0.0% 0.0% 0.0% 3.33sec 4808224 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt 188196 20248783 67496 10.91 258265 741939 54.5 54.5 23.4% 0.0% 0.0% 0.0% 5.34sec 20248783 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt_overload 45284 18678916 62263 11.37 228122 657839 56.8 56.8 23.4% 0.0% 0.0% 0.0% 6.85sec 18678916 300.00sec
Thurible + Terror Thurible + Terror piercing_anguish 246751 9702656 32342 3.20 487076 993635 16.2 16.0 23.4% 0.0% 0.0% 0.0% 18.40sec 9702656 300.00sec
Thurible + Terror Thurible + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.72sec 0 300.00sec
Thurible + Terror Thurible + Terror terror_from_below 242524 15192556 50642 1.93 1266400 2583456 9.6 9.6 23.4% 0.0% 0.0% 0.0% 29.52sec 15192556 300.00sec
Thurible + Terror Thurible + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.51sec 0 300.00sec
Thurible + Terror Thurible + Terror_primal_fire_elemental fire_blast 57984 42514848 199670 26.28 369643 739394 93.2 93.2 23.3% 0.0% 0.0% 0.0% 3.21sec 42514848 212.93sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate 118297 1462649 6869 3.06 109379 218810 10.8 10.8 23.3% 0.0% 0.0% 0.0% 29.16sec 6712836 212.93sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate ticks -118297 5250187 17501 21.66 39291 78585 10.8 108.3 23.4% 0.0% 0.0% 0.0% 29.16sec 6712836 212.93sec
Thurible + Terror Thurible + Terror_greater_lightning_elemental lightning_blast 191726 6910844 172771 55.50 151282 302639 37.0 37.0 23.5% 0.0% 0.0% 0.0% 7.04sec 6910844 40.00sec
Thurible + Tome Thurible + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.94sec 0 300.00sec
Thurible + Tome Thurible + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome earth_shock 8042 84488889 281631 9.53 1259346 3631421 47.6 47.6 21.7% 0.0% 0.0% 0.0% 6.12sec 84488889 300.00sec
Thurible + Tome Thurible + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 95.27sec 0 300.00sec
Thurible + Tome Thurible + Tome flame_shock 188389 2527927 8426 2.26 90296 262720 11.3 11.3 77.2% 0.0% 0.0% 0.0% 27.14sec 37688061 300.00sec
Thurible + Tome Thurible + Tome flame_shock ticks -188389 35160133 117200 42.42 49675 199006 11.3 212.1 77.7% 0.0% 0.0% 0.0% 27.14sec 37688061 300.00sec
Thurible + Tome Thurible + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome insidious_corruption ticks -243941 4123576 13745 9.41 72473 147998 5.2 47.0 20.1% 0.0% 0.0% 0.0% 60.41sec 4123576 300.00sec
Thurible + Tome Thurible + Tome lava_burst 51505 112647215 375493 22.82 0 987093 114.4 114.1 100.0% 0.0% 0.0% 0.0% 2.58sec 112647215 300.00sec
Thurible + Tome Thurible + Tome lava_burst_overload 77451 47011917 156707 11.95 0 786756 59.9 59.8 100.0% 0.0% 0.0% 0.0% 4.86sec 47011917 300.00sec
Thurible + Tome Thurible + Tome volcanic_inferno 205533 4983511 16612 17.01 47712 97349 85.0 85.0 21.9% 0.0% 0.0% 0.0% 3.28sec 4983511 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt 188196 20669707 68899 10.95 271738 770232 54.7 54.7 21.2% 0.0% 0.0% 0.0% 5.39sec 20669707 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt_overload 45284 18959388 63198 11.38 240114 682663 56.9 56.9 21.0% 0.0% 0.0% 0.0% 6.86sec 18959388 300.00sec
Thurible + Tome Thurible + Tome piercing_anguish 246751 9552109 31841 3.20 487076 993635 16.2 16.0 21.6% 0.0% 0.0% 0.0% 18.40sec 9552109 300.00sec
Thurible + Tome Thurible + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.75sec 0 300.00sec
Thurible + Tome Thurible + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.81sec 0 300.00sec
Thurible + Tome Thurible + Tome_primal_fire_elemental fire_blast 57984 43799696 207010 26.28 388823 777787 92.7 92.7 21.5% 0.0% 0.0% 0.0% 3.21sec 43799696 211.58sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate 118297 1515300 7162 3.06 115040 230214 10.8 10.8 22.1% 0.0% 0.0% 0.0% 29.17sec 6929210 211.58sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate ticks -118297 5413909 18046 21.54 41345 82611 10.8 107.7 21.6% 0.0% 0.0% 0.0% 29.17sec 6929210 211.58sec
Thurible + Tome Thurible + Tome_greater_lightning_elemental lightning_blast 191726 7081883 177047 55.50 159130 318275 37.0 37.0 20.3% 0.0% 0.0% 0.0% 7.04sec 7081883 40.00sec
baseline baseline ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.38sec 0 300.00sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline earth_shock 8042 76453422 254846 9.52 1167742 3348631 47.6 47.6 20.1% 0.0% 0.0% 0.0% 6.10sec 76453422 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 96.24sec 0 300.00sec
baseline baseline flame_shock 188389 2330708 7769 2.26 83560 243411 11.3 11.3 76.6% 0.0% 0.0% 0.0% 27.12sec 34675134 300.00sec
baseline baseline flame_shock ticks -188389 32344426 107815 42.42 45963 184641 11.3 212.1 76.8% 0.0% 0.0% 0.0% 27.12sec 34675134 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline lava_burst 51505 103172153 343909 22.85 0 902882 114.5 114.3 100.0% 0.0% 0.0% 0.0% 2.60sec 103172153 300.00sec
baseline baseline lava_burst_overload 77451 43084308 143615 11.98 0 719562 60.0 59.9 100.0% 0.0% 0.0% 0.0% 4.87sec 43084308 300.00sec
baseline baseline volcanic_inferno 205533 4548809 15163 17.03 44190 90151 85.2 85.2 20.1% 0.0% 0.0% 0.0% 3.31sec 4548809 300.00sec
baseline baseline lightning_bolt 188196 18871519 62905 10.92 250979 722974 54.6 54.6 20.1% 0.0% 0.0% 0.0% 5.31sec 18871519 300.00sec
baseline baseline lightning_bolt_overload 45284 17378767 57929 11.37 221937 638775 56.9 56.9 20.1% 0.0% 0.0% 0.0% 6.78sec 17378767 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.74sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 115.81sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 39808239 189473 26.29 360300 720677 92.0 92.0 20.0% 0.0% 0.0% 0.0% 3.24sec 39808239 210.10sec
baseline baseline_primal_fire_elemental immolate 118297 1372957 6535 3.06 106609 213195 10.7 10.7 20.1% 0.0% 0.0% 0.0% 29.49sec 6297246 210.10sec
baseline baseline_primal_fire_elemental immolate ticks -118297 4924290 16414 21.42 38295 76591 10.7 107.1 20.1% 0.0% 0.0% 0.0% 29.49sec 6297246 210.10sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 6555565 163889 55.50 147404 294889 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.04sec 6555565 40.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
14501323.6 14501323.6 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.08% 11.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.63% 11.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.80% 9.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.86% 9.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 13.18% 13.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.64% 9.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.15% 11.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.15%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.25% 10.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.75% 6.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.67% 6.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 14501323.60
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24999
Mean 300.00
Minimum 295.44
Maximum 304.56
Spread ( max - min ) 9.12
Range [ ( max - min ) / 2 * 100% ] 1.52%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24999
Mean 14630413.69
Minimum 13650249.22
Maximum 15588331.70
Spread ( max - min ) 1938082.47
Range [ ( max - min ) / 2 * 100% ] 6.62%
Standard Deviation 246915.0128
5th Percentile 14224647.89
95th Percentile 15035311.07
( 95th Percentile - 5th Percentile ) 810663.18
Mean Distribution
Standard Deviation 1561.6589
95.00% Confidence Intervall ( 14627352.90 - 14633474.49 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1095
0.1 Scale Factor Error with Delta=300 520449579
0.05 Scale Factor Error with Delta=300 2081798316
0.01 Scale Factor Error with Delta=300 52044957892
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 4300889941 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.